Recombinant Human Laminin Subunit Beta-1 (LAMB1) Protein (His-SUMO)

Name: Recombinant Human Laminin Subunit Beta-1 (LAMB1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-03947P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Laminin Subunit Beta-1 (LAMB1) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P07942
Target Symbol	LAMB1
Synonyms	CLM; Cutis laxa with marfanoid phenotype; LAM B1; LAMB 1; LAMB1; LAMB1_HUMAN; Laminin B1; Laminin B1 chain; Laminin beta 1 chain; Laminin beta 1 chain precursor; Laminin beta1; Laminin subunit beta 1; Laminin subunit beta-1; Laminin-1 subunit beta; Laminin-10 subunit beta; Laminin-12 subunit beta; Laminin-2 subunit beta; Laminin-6 subunit beta; Laminin-8 subunit beta; LIS5; MGC142015
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDALERKYEDNQRYLEDKAQELARLEGEVRSLLKDAISQKVAVY
Expression Range	1533-1782aa
Protein Length	Partial
Mol. Weight	44.3 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Involved in the organization of the laminar architecture of cerebral cortex. It is probably required for the integrity of the basement membrane/glia limitans that serves as an anchor point for the endfeet of radial glial cells and as a physical barrier to migrating neurons. Radial glial cells play a central role in cerebral cortical development, where they act both as the proliferative unit of the cerebral cortex and a scaffold for neurons migrating toward the pial surface.
Subcellular Location	Secreted, extracellular space, extracellular matrix, basement membrane. Note=Major component.
Database References	HGNC: 6486 OMIM: 150240 KEGG: hsa:3912 STRING: 9606.ENSP00000222399 UniGene: PMID: 29479990 Treatment of Neuroscreen-1 (NS-1) cells with laminin-1 or YIGSR peptide, which corresponds to a sequence in laminin-1 beta1 chain that binds to 67LR, induced a decrease in the cell-surface expression of 67LR and caused its internalization. PMID: 29108990 In vitro activation of PDGFR-alpha leads to translational activation of LAMB1, which in turn induces an invasive and metastatic phenotype of hepatocellular carcinoma cells exhibiting K19 expression. PMID: 28783171 LAMB1 may affect the initiation and progression of pneumoconiosis, or serve as a potential biomarker of pneumoconiosis for diagnosis and genetic susceptibility. PMID: 28444932 LAMB1 is a potential serological biomarker that could be used in conjunction with carcinoembryonic antigen for diagnosis of colorectal cancer. PMID: 26359947 These results suggest that MUC5B production can be regulated by ECM components and that MUC5B is upregulated by fibronectin and laminin via the integrin, ERK, and NF-kappaB dependent pathway. PMID: 26057585 An association was found between LAMB1 rs2158836 polymorphisms and symptom severity in Korean autism spectrum disorder patients. PMID: 25774865 LAMB1 single nucleotide polymorphism rs886774 was associated with early onset Ulcerative colitis and, thus, suggests a fundamentally different mechanism of early disease pathogenesis in Ulcerative colitis versus Crohn's disease. PMID: 25664710 Upregulation of LAMB1 expression was highly correlated with the downregulation of miR-124-5p. LAMB1 protein expression was suppressed by miR-124-5p. PMID: 24497408 The phenotype due to LAMB2 mutations appears to be similar between different ethnic groups. PMID: 23679161 Homozygous deleterious mutations in LAMB1. PMID: 23472759 Laminin beta1 and integrin alpha2 expression is elevated in the anterior temporal neocortex tissue from patients with intractable epilepsy. PMID: 21370991 We did not find an association of rs6949033 (LAMB1) with ulcerative colitis. PMID: 21744425 mRNA encoding laminin-alpha1, -beta1, and -gamma1 chains was expressed in 90% of endometriotic lesions. PMID: 12615822 alteration of LAMB1 expression is associated with the genesis and development of uterine leiomyoma PMID: 15706419 laminin beta1 chain (a constituent of laminin-8) was typically found in vessel walls of carcinomas and their metastases but not in those of normal breast PMID: 15987446 laminin supports platelet adhesion depending on the interaction of VWF and GPIb-IX-V under pathophysiological high shear flow PMID: 18450753 Meningiomas increase in size through increased production of extracellular matrix; furthermore, the proliferation of cells typically associated with neoplasia requires considerable interaction with the extracellular matrix. PMID: 18474427 Elevated expression of laminin beta1 mRNA and protein in the hippocampus suggests that laminin beta1 may play a role in the development of epileptic seizures in patients with intractable epilepsy. PMID: 18691630 beta2 chain-containing laminins (beta2-laminins) bound more avidly to alpha3beta1 and alpha7X2beta1 integrins than beta1 chain-containing laminins (beta1-laminins). PMID: 19147489 The presence of nuclear beta-catenin and high content of mmp-9 in the tumor were associated with abnormal accumulation of laminin in the cytoplasm. These changes were characteristic of colorectal cancer with high invasive metastatic potential. PMID: 19526105 LAMB1 new susceptibility loci for ulcerative colitis PMID: 19915572

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.