Recombinant Human Laminin Subunit Alpha-5 (LAMA5) Protein (His-SUMO)

Name: Recombinant Human Laminin Subunit Alpha-5 (LAMA5) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-02793P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) LAMA5.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Laminin Subunit Alpha-5 (LAMA5) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O15230
Target Symbol	LAMA5
Synonyms	KIAA0533; KIAA1907; LAMA5; LAMA5_HUMAN; Laminin alpha 5 chain; Laminin subunit alpha 5; Laminin subunit alpha-5; Laminin; alpha 5; Laminin-10 subunit alpha; Laminin-11 subunit alpha; Laminin-15 subunit alpha; RP11-157P1.6
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPAYCGCMRRLAVNRSPVAMTRSVEVHGAVGASGC
Expression Range	3401-3692aa
Protein Length	Partial
Mol. Weight	47.1kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
Subcellular Location	Secreted, extracellular space, extracellular matrix, basement membrane. Note=Major component.
Database References	HGNC: 6485 OMIM: 601033 KEGG: hsa:3911 STRING: 9606.ENSP00000252999 UniGene: PMID: 29908552 This study shows that specific laminin alpha5 substrates provide a controlled in vitro culture environment for human pluripotent stem cells-derived neurons. PMID: 28926760 study describes the first LAMA5 mutation that causes a novel complex extracellular matrix syndrome PMID: 28735299 data show that the BCAM/LAMA5 system plays a functional role in the metastatic spreading of KRAS-mutant colorectal cancer PMID: 27143691 Taken together, these data suggest that alpha5-containing laminins repress intestinal differentiation in its early stages. PMID: 29198708 We report here a severe defect of neuromuscular transmission in a consanguineous patient with a homozygous variant in the laminin alpha-5 subunit gene (LAMA5). The variant c.8046C>T (p.Arg2659Trp) is rare and has a predicted deleterious effect. The affected individual, who also carries a rare homozygous sequence variant in LAMA1, had muscle weakness, myopia, and facial tics PMID: 28544784 The Laminin-511 consists of alpha5, beta1, and gamma1 chains, of which three laminin globular domains of the alpha5 chain (alpha5/LG1-3) and a Glu residue in the C-terminal tail of chain gamma1 (gamma1-Glu1607) are required for binding to integrins. PMID: 28412362 The association of LAMA5 rs4925386 alleles with both inter-individual differences in height and in longevity suggests that laminins may be among the factors linking stature and cancer susceptibility. PMID: 26968355 disruption of the LAMA5 gene dramatically reduced hPSC self-renewal and increased apoptosis without affecting the expression of pluripotency markers. PMID: 26235893 Gal-1 decreased the expression of collagen genes COL3A1 and COL5A1 but increased the expression of fibronectin and laminin 5. PMID: 24503541 Lutheran (Lu), also known as basal cell adhesion molecule (B-CAM), competes with integrins for binding to laminin alpha5, a subunit of LM-511, a major component of basement membranes. PMID: 24036115 The laminin-5 staining pattern was significantly more often continuous in severe dysplasia/carcinoma-in-situ PMID: 23715200 mechanistic role of laminin-511 in tissue homeostasis PMID: 22666383 Polymorphisms in LN5 were associated with a reduced level of hemoglobin and neutropenia in non-small cell lung cancer. PMID: 21461966 These results indicate specific laminin isoforms and integrins in maintenance of human embryonic stem cells pluripotency in feeder-dependent cultures. PMID: 22099024 PDGF-BB is not superior to laminin as a potential marker of advanced CP. PMID: 21921666 Data indicate that the function-blocking antibody against Lu/B-CAM should be useful for not only investigating cell adhesion to laminin alpha5 but also for developing drugs to inhibit sickle cell vaso-occlusion. PMID: 21858073 Cytoplasmic and basement membrane laminin is important in the pathogenesis and invasion of basal cell carcinoma. PMID: 19615022 investigated the relation between epithelial-mesenchymal transition criteria and laminin-332 expression in a cell culture model of transforming growth factor beta-1 (TGFbeta1)/epithelial growth factor (EGF) long time co-stimulation. PMID: 20819124 Abnormal distribution of laminin alpha1 and laminin alpha5 in glomerular basement membrane is correlated with GBM thickening and splitting in human Alport's syndrome. PMID: 20019771 LAMA5 rs659822 regulates anthropometric and metabolic traits in elderly people PMID: 20951195 Data from experiment with peptide fragments suggest laminin alpha5 (and laminin alpha4) may be part of host defense response and may protect tissues from invading pathogens. PMID: 20433883 Laminin-10/11 and fibronectin differentially prevent apoptosis induced by serum removal via phosphatidylinositol 3-kinase/Akt- and MEK1/ERK-dependent pathways (Laminin 10; separate entry for Laminin 11). PMID: 11891225 LN5 has a role in the differentiation of the tracheal epithelium in human embryos PMID: 12242717 LN6 and LN5 have distinct biological activities, but they may cooperatively support cell adhesion PMID: 12379663 role for laminin-5 during human embryogenesis, for example, for epithelial cell development, beyond its involvement in hemidesmosome formation and cell adhesion. PMID: 12382139 Laminins with alpha1, alph4, and alpha5 chains are compared to determine laminin isoform-specific promotion of adhesion and migration of human bone marrow progenitor cells. PMID: 12393739 Our results elucidate a mechanism whereby mesangial cells organize the glomerular capillaries by adhering to the G domain of laminin alpha5 in the glomerular basement membrane. PMID: 12682087 Data suggest that laminin-10 (alpha5beta1gamma1) is required for hair follicle development and report the first use of exogenous protein to correct a cutaneous developmental defect. PMID: 12743034 Incubation of mouse macrophages with human laminin alpha5 chain peptide results in marked increase in matrix metalloproteinase-9 mRNA and gelatinolytic activity; this peptide is chemotactic for mouse neutrophils and macrophages in vitro and in vivo. PMID: 12817023 Autocrine LM-5 mediates anchorage-independent survival in breast tumors through ligation of a wild-type, but not a cytoplasmic tail-truncated alpha6beta4 integrin. PMID: 14691145 prostate cancer cells expressing high levels of MT1-MMP have increased invasive potential through their ability to degrade and invade Ln-10 barriers PMID: 15967115 Protein kinase A-dependent phosphorylation of Lutheran/basal cell adhesion molecule glycoprotein regulates cell adhesion to laminin alpha5 PMID: 15975931 An increase was noted in LAMA5 immunostaining in the dilated muscle of the ganglionic bowel upstream the distal aganglionic region in a group of Hirschprung disease patients. PMID: 16226104 Results describe the expression of laminin 5 by parental and c-Ha-ras-transformed HaCaT keratinocytes in organotypic cultures. PMID: 16460839 laminin 5 and p16INK4A have roles in wound healing and senescence PMID: 16723698 The results indicate that glioma cells secrete alpha2-, alpha4- and alpha5-laminins and that alpha3- and alpha5-laminins, selectively promote glioma cell migration and identify alpha3beta1 as the predominant integrin and laminin receptor in glioma cells. PMID: 17888902 alpha5-laminin was the most adhesion- and migration-promoting isoform for human blood lymphocytes, followed by alpha3- (Lm-332) and alpha4- (Lm-411) laminins. PMID: 18523231 These results suggest that laminins containing alpha 5 serve as functional substrates regulating progression of hepatocellular carcinoma. PMID: 18635166 results suggest an evolutionarily conserved role of a member of the laminin gene family in contributing to variation in weight and body composition PMID: 18694491

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.