Recombinant Human Lactadherin (MFGE8) Protein (His-SUMO)

Name: Recombinant Human Lactadherin (MFGE8) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-03096P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Lactadherin (MFGE8) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q08431
Target Symbol	MFGE8
Synonyms	BA46; Breast epithelial antigen BA46; EDIL1; HMFG; hP47; HsT19888; Lactadherin; Medin; MFG-E8; MFGE8; MFGM; MFGM_HUMAN; Milk fat globule EGF factor 8; Milk fat globule EGF factor 8 protein; Milk fat globule-EGF factor 8; O acetyl disialoganglioside synthase; OAcGD3S; SED1; SPAG10; Sperm associated antigen 10; Sperm surface protein hP47
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
Expression Range	24-387aa
Protein Length	Full Length of Mature Protein
Mol. Weight	56.8kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization. Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction.; Main constituent of aortic medial amyloid.
Subcellular Location	Membrane; Peripheral membrane protein. Secreted. Cytoplasmic vesicle, secretory vesicle, acrosome membrane; Peripheral membrane protein.
Database References	HGNC: 7036 OMIM: 602281 KEGG: hsa:4240 STRING: 9606.ENSP00000268150 UniGene: PMID: 30156356 MFGE8 polymorphisms were not associated with MetS but were related to DBP, HDL-C level, and WC in Chinese adults. PMID: 30053459 This study showed for the first time that MFG-E8 expression is impaired in the endometrium of patients with endometriosis and infertility during the window of implantation. PMID: 28967712 Our findings suggest that both MFGE8 and TGFbeta1 are agerelated inflammatory factors and are related to the degree of Atherosclerosis (AS). In conclusion, both MFGE8 and TGFbeta1 may serve as potential markers of the severity of AS PMID: 29152651 Elevated serum MFG-E8 levels may be associated with cerebrovascular diseases or neuropsychiatric systemic lupus erythematosus. PMID: 28266034 Circulating MFG-E8 levels are dramatically elevated in pregnancy, and are significantly higher in gestational diabetes mellitus than in normal pregnancy. PMID: 28035763 MFG-E8 could be a potential novel prognostic marker for colorectal cancer (CRC) and overexpression of MFG-E8 might be involved in lymph node metastasis and angiogenesis of CRC. PMID: 28923329 MFG-E8 levels are elevated in T2D but suppressed by increased adipose tissues, thereby allowing inflammatory factors to rise to high levels. MFG-E8 may serve as a potential biomarker for obesity and T2D in the clinical setting PMID: 28067023 These findings provide a better understanding of the molecular mechanism underlying colorectal cancer progression and suggest a predictive role for MFG-E8 in colorectal cancer metastasis and prognosis PMID: 28653875 Levels of MFGE8 were reduced in cirrhotic liver tissue from patients compared with controls. PMID: 27956229 an efficient purification method for production of non-aggregated, full-length MFG-E8. PMID: 27102803 Reduced serum milk fat globule-epidermal growth factor 8 (MFG-E8) concentrations are associated with an increased risk of microvascular complications in patients with type 2 diabetes. PMID: 28089751 MFG-E8 is a protective factor in the pathogenesis of rheumatoid arthritis and subsequent bone loss. PMID: 26391522 After myocardial infarction, Mfge8 (and Mertk)-expressing macrophages synergistically engage the clearance of injured cardiomyocytes. PMID: 26819373 Studied the therapeutic effect of rhMFG-E8 in mouse models of IBD. Treatment with rhMFG-E8 significantly attenuated colitis in both models in a dose-dependent way. PMID: 25751740 MFG-E8 promotes cutaneous wound healing by enhancing angiogenesis. PMID: 24838098 Lactadherin may decrease inflammation by inhibiting secretory phospholipase A2 activity on pre-apoptotic leukemia cells. PMID: 24194865 promotes tumor progression in oral squamous cell carcinoma PMID: 25264705 MFG-E8 had a negative association with hs-CRP and a positive association with LDL-c. The serum level of MFG-E8 was negatively associated with the severity of coronary artery stenosis and the risk of clinical events. PMID: 24561551 medin adopts a predominantly beta-sheet conformation with some unstructured elements. PMID: 24602872 MFG-E8 could be used as a biomarker for diagnosis and monitoring of disease activity in certain systemic lupus erythematosus patients PMID: 24554711 Exogenously added MFG-E8 inhibits receptor activator NF-kappaB ligand-induced osteoclastogenesis of human osteoclast precursors. PMID: 24958900 Our results strongly suggested that MFG-E8 is a promising biomarker for the diagnosis, prognosis, and therapy target of opisthorchiasis-associated cholangiocarcinoma PMID: 24122204 Blockage of MFG-E8 in endometrial tumor cells diminishes trophoblaast cell attachment. PMID: 24424369 TNF-alpha up-regulates endometrial epithelial cell migration and MFG-E8 production. PMID: 24262600 MFG-E8-dependent promotion of apoptotic cell clearance is a novel anti-inflammatory facet of glucocorticoid treatment PMID: 23832117 our data argue that MFGE8 is not likely involved in the phagocytic clearance of neuronal debris associated with nigrostriatal pathway injury. PMID: 23194669 NMR solution structure of C2 domain of MFG-E8 and insights into its molecular recognition with phosphatidylserine PMID: 23262193 Milk fat globule-epidermal growth factor 8 has proapoptotic activity, suggesting participation in endometrial remodeling via an epithelial-stromal cell paracrine effect. PMID: 22921913 MFG-E8 expression in the endometrial epithelium as well as in chorionic villi suggests its possible role in endometrial reorganization during the receptive phase and in events related to normal pregnancy in mammals PMID: 22770563 Decreased colonic MFGE8 expression in patients with ulcerative colitis may be associated with mucosal inflammatory activity and clinical disease activity through basal cell apoptosis and preventing tissue healing in the pathogenesis of ulcerative colitis PMID: 22204000 a key role of MFG-E8 release from apoptotic endothelial cells in macrophage reprogramming PMID: 22558449 The distribution of the SNP (rs4945 and rs1878326) of MFGE8 was analyzed in two groups of patients with "wet" age-related macular Degeneration and their age-matched controls. PMID: 22438901 serum lactadherin is correlated with poor blood glucose control and diabetic vascular complications. PMID: 22018779 We conclude that MFG-E8-dependent signaling stimulates cell proliferation and the acquisition of mesenchymal properties and contributes to mammary carcinoma development. PMID: 21841820 in vitro studies showed that medin amyloid-like fibrils promote the aggregation of protein amyloid A into fibrils PMID: 22070546 Prolactin has a modulatory role for as a stromal/epithelial paracrine factor controlling MFG-E8. This is the first report on MFG-E8 protein localization to the human endometrial epithelium and its up-regulation during the window of implantation. PMID: 21177637 MFG-E8 is expressed in triple-negative breast cancers as a target gene of the p63 pathway, but may serve a suppressive function in ER(+) and erbB2(+) breast cancers. PMID: 21127199 overexpression of MFGE8 during bladder tumor development, correlated with expression of genes involved in cell adhesion or migration and in immune responses. PMID: 20956946 intronic mutation in the human MFG-E8 gene can lead to the development of SLE. PMID: 20213738 SED1 is expressed on the surface of acrosome-intact human sperm and in the anterior caput of the human epididymis, similar to that seen in mouse PMID: 18990388 Truncated fragment of medin, the hexapeptide, NFGSVQ can form typical amyloid fibrils. PMID: 15478463 Might prove useful in the treatment of prolonged ischemia. PMID: 16115445 Lactadherin) is expressed in normal and atherosclerotic human arteries. PMID: 17420351 The trans-activator (TA) isoforms of p63 activate MFGE8 transcription though a p53/p63 motif at -370, which was confirmed by a chromatin immunoprecipitation experiment. PMID: 17637751 Identification of the last 18-19 amino acid residues as constituting the amyloid-promoting region of medin. PMID: 17679143 aggregated medin induced death of aortic smooth muscle cells in vitro. Cells incubated together with medin increased the production of matrix metalloproteinase-2, a protease that degrades elastin and collagen and subsequently weakens the vessel wall. PMID: 17906662 analysis of membrane-interactive loops of Lact-C2 PMID: 18160406 Some childhood-onset and adult SLE patients carried a significant level of MFG-E8 in their blood samples. PMID: 18303131 Lactadherin promoted phagocytosis of phosphatidylserine-expressing RBCs by macrophages in a concentration-dependent manner. PMID: 18647368

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.