Recombinant Human L-Lactate Dehydrogenase B Chain (LDHB) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10686P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human L-Lactate Dehydrogenase B Chain (LDHB) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10686P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human L-Lactate Dehydrogenase B Chain (LDHB) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P07195
Target Symbol LDHB
Synonyms Epididymis secretory protein Li 281; HEL S 281; L lactate dehydrogenase B chain; L-lactate dehydrogenase B chain; Lactate Dehydrogenase B; Lactate dehydrogenase H chain; LDH B ; LDH H; LDH heart subunit; LDH-B; LDH-H; LDHB; LDHB_HUMAN; LDHBD; LDHH; Renal carcinoma antigen NY REN 46; Renal carcinoma antigen NY-REN-46; TRG-5; TRG5
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Expression Range 2-334aa
Protein Length Full Length of Mature Protein
Mol. Weight 40.5kDa
Research Area Metabolism
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location Cytoplasm. Mitochondrion inner membrane; Peripheral membrane protein.
Protein Families LDH/MDH superfamily, LDH family
Database References

HGNC: 6541

OMIM: 150100

KEGG: hsa:3945

STRING: 9606.ENSP00000229319

UniGene: PMID: 28756978

  • this study shows that low base line lactate dehydrogenase is linked with a better tumor response, and that prolonged overall survival and progression-free survival are observed for patients under ipilimumab treatment with no increase in lactate dehydrogenase PMID: 27485076
  • our study examines the inclusion of salivary LDH as potential diagnostic parameter and therapeutic index in Oral squamous cell carcinoma PMID: 26577856
  • addition of exogenous lactic acid to growth media was sufficient to induce cell death that could be inhibited by the expression of LDHB. the results suggest that lactate dehydrogenase is a general suppressor of programmed cell death in yeast. PMID: 26032856
  • The aim of this study was to demonstrate the effects of 6-week low-intensity training on changes in indicators of aerobic capacity and on HSPA1A, HSPB1, and LDHb expression in white blood cells in high level rowers. PMID: 26214432
  • Lactate dehydrogenase B is associated with the response to neoadjuvant chemotherapy in oral squamous cell carcinoma. PMID: 25973606
  • The readthrough-extended lactate dehydrogenase subunit LDHBx can also co-import LDHA, the other LDH subunit, into peroxisomes. PMID: 25247702
  • We were able to provide evidence that methylation of HLTF and especially HPP1 detected in serum is strongly correlated with cell death in CRC using LDH as surrogate marker PMID: 24708595
  • This meta-analysis shows that high serum LDH level is obviously associated with lower overall survival rate in patients with osteosarcoma, and it is an effective biomarker of prognosis. PMID: 24682390
  • These observations support prospective clinical evaluation of LDHB as a predictive marker of response for patients with breast cancer receiving neoadjuvant chemotherapy. PMID: 23697991
  • This study identifies LDHB as a regulator of cell proliferation in a subset of lung adenocarcinoma and may provide a novel therapeutic approach for treating lung cancer PMID: 23224736
  • LDH concentrations in nasopharyngeal secretions are positively associated with acute otitis media risk. PMID: 23202721
  • Loss of LDH-B expression is an early and frequent event in human breast cancer occurring due to promoter methylation, and is likely to contribute to an enhanced glycolysis of cancer cells under hypoxia. PMID: 23437403
  • ata indicate that serum lactic dehydrogenase (S-LDH) appears to be a significant independent prognostic index in patients with metastatic nasopharyngeal carcinoma (NPC). PMID: 23266049
  • Patients with severe vaso-occlusive crisis were more frequently males, who also had higher white blood cell (WBC) count, procalcitonin (PCT), and lactate dehydrogenase (LDH) levels. PMID: 22892192
  • Data reveal that LDHB is upregulated and required only in certain cancer genotypes. PMID: 23139210
  • results indicate that histone deacetylase inhibitors upregulate miRNAs, at least some of which act as tumor suppressors. lactate dehydrogenase B, which is regulated by the tumor suppressive miR-375, may therefore act as an oncogene in esophageal squamous cell carcinoma. PMID: 22752059
  • Serum lactate dehydrogenase is a prognostic and predictive biomarker for survival benefit conferred by TORC1 inhibition in poor-risk renal cell carcinoma. PMID: 22891270
  • Data indicate that serum lactate dehydrogenase (LDH) seemed able to predict clinical outcome for hepatocellular carcinoma (HCC) patients undergoing hepatocellular carcinoma (HCC). PMID: 22461886
  • The significant elevation in serum CK [creatine kinase ]and LDH [L-Lactate Dehydrogenase ] activities indicates that these can be used as parameters for screening hypothyroid patients but not hyperthyroid patients. PMID: 22248949
  • results confirmed the prognostic roles of LDH-B in urinary bladder urothelial carcinoma. PMID: 22027740
  • Results suggest that lactate dehydrogenase B suppression plays an important role in triggering or maintaining the mitochondrial defects and then contributes to cancer cell invasiveness by inducing claudin-1 protein. PMID: 21356207
  • Elevated serum LDH isoenzymes and AST indicate a disturbance (of uncertain clinical significance) within multiple extraosseous tissues when there is CLCN7 deficiency. PMID: 20499337
  • findings offer proof of concept for targeting LDHB as a therapeutic strategy in cancers driven by aberrant activation of the RTK-PI3K-AKT-mTOR signaling cascade PMID: 21199794
  • S100B and LDH are not expressed in sentinel node progression of melanoma PMID: 20592382
  • LDHB was elevated in idiopathic myelofibrosis. This isoenzymatic pattern could be expression of a metabolic adaptation. PMID: 17178662
  • MYC, LDHB, and CCNB1 may have roles in progression of medulloblastoma PMID: 18593994
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed