Recombinant Human L-Lactate Dehydrogenase A Chain (LDHA)

Name: Recombinant Human L-Lactate Dehydrogenase A Chain (LDHA)
Brand: Beta LifeScience
SKU: BLC-02153P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human L-Lactate Dehydrogenase A Chain (LDHA) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P00338
Target Symbol	LDHA
Synonyms	Cell proliferation-inducing gene 19 protein; GSD11; L lactate dehydrogenase B chain; L-lactate dehydrogenase A chain; Lactate dehydrogenase A; Lactate dehydrogenase B; Lactate dehydrogenase c variant 1; Lactate dehydrogenase c variant 3; Lactate dehydrogenase c variant 4; Lactate dehydrogenase C4; Lactate dehydrogenase H chain; Lactate dehydrogenase M; LDH A; LDH B; LDH H; LDH heart subunit; LDH M; LDH muscle subunit; LDH-A; LDH-M; LDH1; ldha; LDHA_HUMAN; LDHBD; LDHM; MS1111; PIG19; Proliferation inducing gene 19; Proliferation-inducing gene 19; Renal carcinoma antigen NY REN 46; Renal carcinoma antigen NY-REN-59; TRG 5; TRG5
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	Tag-Free
Target Protein Sequence	KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL
Expression Range	5-323aa
Protein Length	Partial
Mol. Weight	35.1 kDa
Research Area	Metabolism
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location	Cytoplasm.
Protein Families	LDH/MDH superfamily, LDH family
Database References	HGNC: 6535 OMIM: 150000 KEGG: hsa:3939 STRING: 9606.ENSP00000445175 UniGene: PMID: 30213286 hCINAP determines self-renewal of colorectal cancer stem cells by facilitating LDHA phosphorylation. PMID: 28516914 the results of the present study demonstrated that miR199a3p can inhibit LDHA expression by downregulating Sp1, and provided mechanistic evidence supporting the existence of a novel miR199a3p/Sp1/LDHA axis and its critical contribution to aerobic glycolysis in testicular cancer cells. PMID: 30015851 High LDHA expression is associated with Non-Small Cell Lung Cancer. PMID: 29321091 This is the first study from this highly prevalent region of Head neck cancer showing that serum LDH could be regarded as a biomarker for malignant and premalignant conditions of the head and neck. PMID: 30197328 High LDH expression is associated with small cell lung cancer. PMID: 29970686 The PFK2 expression along with LDH-4 were observed to be increased ~2-fold (P < 0.001) in 0.5 mM ammonia treated brain slices. PMID: 23703029 miR-199a-3p is a major metabolic regulator in tumor suppression and miR-199a-3p may downregulate metabolic genes (LDHA, PGK1, MCT1, TIGAR) through the transcription factor Sp1. PMID: 27432288 The expression of LDH-5 and hypoxia-inducible factor (HIF) 1alpha in Non-Hodgkin's lymphoma, was examined. PMID: 24086384 Results show that LDHA is highly expressed in triple negative breast cancer (TNBC) and correlated with a poor outcome. Its 3'UTR is targeted by miR-34a. Also, LDHA along with PDL1 seem to act as ceRNAs to promote the expression and function of each other through regulation of miR-34a in TNBC. PMID: 28915924 LDHA siRNA can inhibit cell proliferation, induce apoptosis, reduce invasion and migration in renal cell carcinoma cells. PMID: 27027898 JMJD2A regulated aerobic glycolysis by regulating LDHA expression. Therefore, the novel JMJD2A-LDHA signaling pathway could contribute to the Warburg effects in NPC progression. PMID: 28693517 The present study proved that HIF1/2alpha could activate LDHA expression in human pancreatic cancer cells, and high expression of LDHA promoted the growth and migration of pancreatic cancer cells. PMID: 28193910 Pretreatment LDH levels had noticeable prognostic value in advanced pancreatic ductal adenocarcinoma (PDAC) patients who received subsequent chemotherapy. Tackling elevated LDH levels before the initiation of chemotherapy might be a promising measure for improving overall survival of patients after treatment for their advanced PDAC. PMID: 28056913 Authors demonstrated that knock down of LDHA with siRNA or inhibition of LDHA activity with a LDHA specific inhibitor (FX-11), could sensitize PC-3RR cells to radiotherapy with reduced epithelial-mesenchymal transition, hypoxia, DNA repair ability and autophagy, as well as increased DNA double strand breaks and apoptosis. PMID: 27708237 Taken together, these results indicate that miR-142-3p could act as a tumor suppressor in HCC by targeting LDHA, suggesting new therapeutic targets for HCC treatment. PMID: 29360449 Findings suggest that miR-34b-3 and miR-449a suppress the development of nasopharyngeal carcinoma (NPC) through regulation of glycolysis via targeting lactate dehydrogenase A.(LDHA) and may be potential therapeutic targets for the treatment of NPC. PMID: 27458165 Results provide evidence that miR-200b acts as a tumor suppressor in glioma through the inhibition of LDHA both in vitro and in vivo. PMID: 27374173 our data demonstrate that overexpression of 14-3-3zeta in early stage pre-cancerous breast epithelial cells may trigger an elevated glycolysis and transcriptionally up-regulating LDHA, thereby contributes to human breast cancer initiation. PMID: 27150057 serum lactate dehydrogenase has a role in predicting the outcome of resected gastric cancer and construct prognostic nomograms for risk prediction PMID: 27223065 LDHA phosphorylation and activation provide pro-invasive, anti-anoikis and pro-metastatic advantages to cancer cells, suggesting that Y10 phosphorylation of LDHA may represent a promising therapeutic target and a prognostic marker for metastatic human cancers. PMID: 28218905 miR-30a-5p may function as a tumor suppressor in breast cancer through the inhibition of LDHA expression and glycolysis. PMID: 28461244 Overexpression of LDHA can be a marker of poor prognosis in cholangiocarcinoma patients PMID: 27615379 LDHA-associated lactic acid accumulation in melanomas inhibits tumor surveillance by T and natural killer cells. PMID: 27641098 Data indicate that lactate dehydrogenase A (LDHA) is involved in the transcription of histone 2B gene. PMID: 28257841 LDHA downregulation is involved in the apoptotic effect of diallyl trisulfide in triple-negative breast cancer. PMID: 27566995 this study shows that low levels of LDH correlate to a better anti-CTLA-4 immunotherapy response and survival in advanced melanoma patients PMID: 27728898 alternative isoforms of LDH in cancer cells produce lactic acid, when LDHA is silenced or inhibited PMID: 28314283 Overexpression of PKM2 and LDH5 associates with key clinicopathological features and unfavourable prognosis in tongue squamous cell carcinoma. PMID: 24762230 These results suggest LDH-A and/or lactate as common elements at the cross-road between cancer cell metabolism, tumor progression and inflammation PMID: 27622920 High serum LDH is associated with OS and PFS in patients with urinary system cancer, and it is an effective biomarker of prognosis in patients with urologic cancer. PMID: 27710971 High serum LDH level is associated with cancer. PMID: 27511116 The number of in advanced-stage diffuse large B cell lymphoma patients with elevated serum lactate dehydrogenase who achieved complete response (CR) after R-CHOP in the non autologous hematopoietic stem cell transplantation (ASCT) group was higher than that in the ASCT group. PMID: 27324387 this study shows that elevated serum LDH levels are associated with unfavorable prognosis in nasopharyngeal carcinoma patients treated with intensity-modulated radiotherapy PMID: 26928265 LDHA is a direct target of miR-34a in regulating glucose metabolism and tumor growth in breast cancer. PMID: 26902416 IDO, through GCN2 kinase activation, downregulates the levels of TCRcomplex tchain and cMyc, resulting in the suppression of Tcell proliferation and a reduction in the levels of LDHA and GLS2 PMID: 26647830 Findings provide evidence of the cellular functions of lactate dehydrogenase A in the progression of glioblastoma and suggest that lactate dehydrogenase A might act as a potential therapeutic target for glioblastoma treatment. PMID: 26694942 Reanalysis of genome-wide association study and in vitro validation show that lactate dehydrogenase interacts with branched-chain amino acid metabolism. PMID: 26014429 LDH and complex I play distinct roles in regulating glycolysis and cell proliferation. Inhibition of these two augments synthetic lethality in melanoma. PMID: 26484566 Multivariable analysis showed that combined expression of pyruvate kinase type M2 and lactate dehydrogenase A was an independent poor prognostic marker for survival. PMID: 26989901 Although lactate dehydrogenase A (LDHA) expression varies biphasically during melanoma brain metastasis formation, tumor progression and survival seem to be functionally independent of LDHA. PMID: 25791837 dehydrogenase A negatively regulated by miRNAs promotes aerobic glycolysis and is increased in colorectal cancer. PMID: 26062441 positive relationship between LDH-A expression and CSC/EMT markers was confirmed both in invasive bladder cell line and in 136 MIBC specimens. PMID: 26721441 FOXM1-LDHA signaling functioned as a stimulator of glycolysis and promoted gastric cancer progression. PMID: 26261559 Mammalian photoreceptors contain dimeric and tetrameric PKM2 and LDH-A. This is consistent with the ability to switch between energy production and biosynthesis like a proliferating tissue, possibly due to demands of opsin synthesis. PMID: 26780311 We propose a profibrotic feed forward loop, in which radiation induces LDHA expression and lactate production, which can lead to further activation of TGF-beta to drive the fibrotic process. PMID: 26254422 These results indicate that disrupting SLC2A1, LDHA, or other regulators in cancer cell energetics is a very promising approach for new targeted therapies. PMID: 25838393 High expression of LDHA is associated with gastric cancer. PMID: 25913622 High LDHA expression is associated with tumor progression in prostate cancer. PMID: 25983002 LDHA is downregulated by JQ1, which suppresses tumor growth in ovarian cancer PMID: 25762632

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.