Recombinant Human Killer Cell Immunoglobulin-Like Receptor 2Ds3 (KIR2DS3) Protein (MBP&His)
Beta LifeScience
SKU/CAT #: BLC-08888P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Killer Cell Immunoglobulin-Like Receptor 2Ds3 (KIR2DS3) Protein (MBP&His)
Beta LifeScience
SKU/CAT #: BLC-08888P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Killer Cell Immunoglobulin-Like Receptor 2Ds3 (KIR2DS3) Protein (MBP&His) is produced by our Baculovirus expression system. This is a extracellular protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q14952 |
| Target Symbol | KIR2DS3 |
| Synonyms | KIR2DS3; NKAT7Killer cell immunoglobulin-like receptor 2DS3; MHC class I NK cell receptor; Natural killer-associated transcript 7; NKAT-7 |
| Species | Homo sapiens (Human) |
| Expression System | Baculovirus |
| Tag | N-MBP&C-6His |
| Target Protein Sequence | HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH |
| Expression Range | 22-245aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 68.7 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
| Protein Families | Immunoglobulin superfamily |
| Database References | HGNC: 6335 OMIM: 604954 KEGG: hsa:3808 UniGene: PMID: 28993188 |
