Recombinant Human Killer Cell Immunoglobulin-Like Receptor 2Ds3 (KIR2DS3) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-02105P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Killer Cell Immunoglobulin-Like Receptor 2Ds3 (KIR2DS3) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-02105P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Killer Cell Immunoglobulin-Like Receptor 2Ds3 (KIR2DS3) Protein (His&Myc) is produced by our E.coli expression system. This is a extracellular protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q14952
Target Symbol KIR2DS3
Synonyms KIR2DS3; NKAT7Killer cell immunoglobulin-like receptor 2DS3; MHC class I NK cell receptor; Natural killer-associated transcript 7; NKAT-7
Species Homo sapiens (Human)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
Expression Range 22-245aa
Protein Length Extracellular Domain
Mol. Weight 31.7 kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Subcellular Location Cell membrane; Single-pass type I membrane protein.
Protein Families Immunoglobulin superfamily
Database References

HGNC: 6335

OMIM: 604954

KEGG: hsa:3808

UniGene: PMID: 28993188

  • Genotypes missing these two inhibitory KIR-HLA combinations in addition to missing activating KIRs 2DS2 and 2DS3 were more common in Vogt-Koyanagi-Harada disease (OR = 1.90, P = 0.002). PMID: 27490240
  • Loss of KIR2DS3 gene is associated with breast cancer. PMID: 27631728
  • genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians PMID: 26472014
  • The genes KIR2DL5, KIR2DS3 and KIR2DS5 were present in a significantly higher proportion of individuals in the asymptomatic control group than in the malaria cases. PMID: 24929143
  • the presence of host genetic risk factors, IL28B-T and KIR2DS3 alleles, resulted in increased odds of treatment failure in these rapid virological response negative patients. PMID: 23826153
  • KIR2DS3 and HLA-class I alleles (-Cw*14 and -Cw*17) may play a role in the pathogenesis of the Vogt-Koyanagi-Harada disease. PMID: 22219647
  • The Natural Killer cell gene KIR2DS3 was significantly increased in patients with chronic hepatitis C virus infection. PMID: 21402922
  • KIR2DS3 is associated with protection against acute myeloid leukemia. PMID: 20371915
  • Positive linkage disequilibrium was seen between KRI2DS2 and KIR2DS3. Positive linkage disequilibrium was seen between KIR3DS1 and KIR2DS3. PMID: 12559621
  • KIR2DS3 is a protective factor for chronic graft-versus-host disease. PMID: 17462498
  • This focuses on the inheritance of KIR2DS3*001 and *002 to clarify their genetic relationship, and will investigate the diversity of haplotypes containing a KIR2DS3 gene. PMID: 18480828
  • Genomic and mRNA sequences support the KIR2DS3*002 gene being a hybrid of KIR2DS3*00103 and KIR2DS5. PMID: 18764809
  • Dramatically reduced surface expression of NK cell receptor KIR2DS3 is attributed to multiple residues throughout the molecule. PMID: 19005473
  • KIR2DS3 incompatibilities increased risk of chronic graft-versus-host disease after allogeneic hematopoietic stem cell transplantation PMID: 19500138
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed