Recombinant Human Killer Cell Immunoglobulin-Like Receptor 2Ds1 (KIR2DS1) Protein (His)

Name: Recombinant Human Killer Cell Immunoglobulin-Like Receptor 2Ds1 (KIR2DS1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03016P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Killer Cell Immunoglobulin-Like Receptor 2Ds1 (KIR2DS1) Protein (His) is produced by our Yeast expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q14954
Target Symbol	KIR2DS1
Synonyms	KIR2DS1; CD158HKiller cell immunoglobulin-like receptor 2DS1; CD158 antigen-like family member H; MHC class I NK cell receptor Eb6 ActI; CD antigen CD158h
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
Expression Range	22-245aa
Protein Length	Extracellular Domain
Mol. Weight	26.8kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor on natural killer (NK) cells for some HLA-C alleles such as w6. Does not inhibit the activity of NK cells.
Subcellular Location	Cell membrane; Single-pass type I membrane protein.
Protein Families	Immunoglobulin superfamily
Database References	HGNC: 6333 OMIM: 604952 KEGG: hsa:3806 UniGene: PMID: 28546555 Study findings determined the detrimental impact of KIR2DS1, 2DS5, 3DS1, 2DL5 and CxT4 genotype on genetic predisposition to head and neck squamous cell carcinoma in Iranians. PMID: 29408295 KIR2DS1 expression by decidual natural killer cells increases their ability to control placental HCMV infection PMID: 27956621 A negative association between the KIR2DS1 polymorphism and susceptibility to type 1 diabetes mellitus was found. PMID: 29384924 KIR2DS1 gene polymorphism is associated with HIV-1 infection. PMID: 26888639 The absence of KIR-2DS1 in the mother and the presence of HLA-C2 ligand in the child were negatively associated with type 1 diabetes in the child. Our results indicate that maternal KIR genes and their interaction with foetal HLA-C2 may contribute to the risk of type 1 diabetes among Han Chinese children PMID: 26991115 KIR2DS1-C2C2 is less frequent in type 1 diabetes in Saudi children PMID: 26542066 Recurrent Pregnancy Loss in Women with Killer Cell Immunoglobulin-Like Receptor KIR2DS1 is Associated with an Increased HLA-C2 Allelic Frequency PMID: 26589762 functional interactions between KIR and HLA modify risks of BCC and SCC and that KIR encoded by the B genes provides selective pressure for altered p53 in BCC tumors. PMID: 26744525 The activating KIR gene KIR2DS1 has an important predictive potential for early onset of type 1 autoimmune hepatitis. PMID: 26744892 Absence of HLA-C2 for donor KIR2DL1 was associated with higher grade II to IV (HR, 1.4; P = .002) and III to IV acute GVHD (HR, 1.5; P = .01) compared with HLA-C2(+) patients. PMID: 25960307 frequency of the maternal KIR2DS1 gene lower in the preeclampsia group than control group PMID: 24911933 Data show that KIR2DL5 receptor, KIR2DS1 protein, KIR2DS5 protein and KIR3DS1 receptors were all significantly associated with high viral load. PMID: 25253288 the frequencies of HLA-Cw07 were statistically significantly higher in the patient group than those in the control group (P = 0.009). KIR2DS1(+) HLA(-) Cw(Lys) was more common in subjects with SLE PMID: 25581336 Moreover, the frequency of activating genotypes in the AS patient group was significantly higher than in the healthy control group (P < 0.05). KIR2DS1 and KIR3DS1 PMID: 25491925 Effect of KIR2DS1 was most significant in pregnancies where its ligand, HLA-C2, was paternally but not maternally inherited by a fetus (p = 0.005, odds ratio = 2.65). PMID: 24778445 Different expression levels of KIR2DL1 may contribute to the abnormal function of natural killer (NK) and NKT lymphocytes, which lead to the risk of systemic lupus erythematosus (SLE) susceptibility. PMID: 24839813 A negative association was found between the activating KIR2DS1 gene and multiple sclerosis. PMID: 24529855 Activation of KIR2DS1 positive decidual natural killer cells by HLA-C2 stimulated production of soluble products including GM-CSF. PMID: 24091323 Frequencies of the great majority of KIR genes did not differ between patients and controls, except for KIR2DS1, whose frequency was significantly lower in patients than in controls PMID: 23831511 many NK cells with anti-HLA-C2 reactivity are present in HLA-C1 homozygous and heterozygous donors with KIR2DS1. PMID: 23554313 Activating KIR genes from donors were associated with distinct outcomes of allogeneic HSCT for AML. Donor KIR2DS1 appeared to provide protection against relapse in an HLA-C-dependent manner, and donor KIR3DS1 was associated with reduced mortality. PMID: 22931314 Data found that the frequencies of KIR2DS1, 2DS3 and 3DS1 were significantly higher in pulmonary tuberculosis patients than in the control group. PMID: 22653583 High KIR2DS1 activation is associated with breast cancer. PMID: 21479698 in this cohort, KIR2DS1(+) patients had significantly lower 2-year probabilities of achieving CCyR and OS than KIR2DS1(-) patients. The impact of KIR2DS1 on CCyR was greatest when the ligand for the corresponding inhibitory receptor, KIR2DL1, was absent PMID: 21844874 In this study, KIR2DS1+HLA-C2 and KIR3DL1+HLA-B Bw4 Ile80 combinations were associated with the vulnerability to ankylosing spondylitis. PMID: 21797986 KIR2DS1 expression may also significantly amplify the size of the alloreactive NK cell subset by switching a subset of "not alloreactive" NK cells into potent alloreactive cells. PMID: 21791599 In alloreactive natural killer-cell responses, KIR2DS1 expression represents a remarkable advantage as it allows efficient killing of C2/C2 or C1/C2 myelomonocitic dendritic cells (DCs) and T-cell blasts. PMID: 21355085 This study suggested that the presence of functional compounds of activating KIR receptors together with their HLA ligands, allowing the immunomodulatory function of NK cells, may have a protective role against the disease. PMID: 20826009 Study showed that the activating KIR2DS1 and KIR2DS3 genes associate with fatal outcome in Ebola virus infection. PMID: 20878400 KIR2DS1 has been associated with autoimmunity and hematopoietic stem cell transplantation, these results pave the way to dissect the function of KIR2DS1 in these clinical conditions. PMID: 20093094 KIR3DS1 and KIR2DS1 may be necessary to trigger an effective early immune response against HPV-infected targets to establish resistance to recurrent respiratory papillomatosis PMID: 19861144 individuals carrying three activating KIR genes 3DS1, 2DS1, and 2DS5 are more frequent in patients with Vogt-Koyanagi-Harada disease than in controls PMID: 19897003 KIR2DS1 genes are overrepresented in combination with KIR2DS3, KIR3DS1 and KIR2DS5. PMID: 12559621 The frequencies of KIR2DS1 and KIR2DL5 were significantly increased in psoriasis vulgaris cases compared with controls PMID: 15140215 Results indicate a role of KIR2DS1 on recognition of HLA-Cw6 in susceptibility to psoriasis. PMID: 15310528 An increase in the frequency of the activating KIR2DS1 gene was detected in the psoriatic arthritis (PsA) patients, compared with psoriasis patients negative for PsA and an unaffected American Caucasian control group. PMID: 16112031 The presence of KIR2DS1 in the donor (n = 16/25) was not demonstrated to influence outcome following donor-hematopoietic cell transplantation. PMID: 16504727 Significantly increased KIR2DS1 is associated with systemic lupus erythematosus and scleroderma PMID: 17445179 These results suggest that activating KIR2DS1 gene may not confer susceptibility to PV, and an association of KIR2DS1 gene with the HLA-Cw*0602+ was observed in these patients. PMID: 18643961 KIR2DS1 incompatibilities increased risk of chronic graft-versus-host disease after allogeneic hematopoietic stem cell transplantation PMID: 19500138 Data show that sHLA-Cw4 or sHLA-Cw3 alleles induced secretion of TGF-beta1 by ligation of stimulatory KIR2DS1 or KIR2DS2 isoforms. PMID: 19830740

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.