Recombinant Human Keratin, Type Ii Cytoskeletal 7 (KRT7) Protein (His-SUMO)

Name: Recombinant Human Keratin, Type Ii Cytoskeletal 7 (KRT7) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-03956P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Keratin, Type Ii Cytoskeletal 7 (KRT7) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P08729
Target Symbol	KRT7
Synonyms	CK 7; CK-7; CK7; Cytokeratin 7; Cytokeratin-7; D15Wsu77e; K2C7; K2C7_HUMAN; K7; Keratin 7; Keratin 7; type II; Keratin type II cytoskeletal 7; Keratin; 55K type II cytoskeletal; Keratin; simple epithelial; Keratin; simple epithelial type I; K7; Keratin; type II cytoskeletal 7; Keratin-7; Krt2-7; KRT7; MGC11625; MGC129731; MGC3625; Sarcolectin; SCL; Type II mesothelial keratin K7; Type-II keratin Kb7
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
Expression Range	2-469aa
Protein Length	Full Length of Mature Protein
Mol. Weight	67.3kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
Subcellular Location	Cytoplasm.
Protein Families	Intermediate filament family
Database References	HGNC: 6445 OMIM: 148059 KEGG: hsa:3855 STRING: 9606.ENSP00000329243 UniGene: PMID: 30194170 High expression of CK-7 is associated with intrahepatic cholangiocarcinoma. PMID: 29513894 Positive expression of CK7 associated with pathological features of lymph node metastasis and T stage may be independent clinical parameters for poor prognosis of patients with lung cancer. PMID: 28827446 Research show that circulating CK7 mRNA positive cells were found in patients with bladder urothelial cancer of varying stages, and the detection rates increased with stage predicting worse clinical scenario. PMID: 28024950 CK7/ HPV-L1 expression, and the presence of koilocytosis can be used for prognostication in patients with cervical low-grade squamous intraepithelial lesions. PMID: 28554573 KRT7-AS formed an RNA-RNA hybrid with KRT7 and controlled KRT7 expression at both the mRNA and the post-transcriptional levels. forced overexpression of the KRT7-overlapping region (OL) of KRT7-AS (but not its non-KRT7-OL portions) increased keratin 7 protein levels in cells. Finally, forced overexpression of full-length KRT7-AS or OL KRT7-AS (but not its non-KRT7-OL regions) promoted GC cell proliferation PMID: 26876208 These data support the theory that CK7 staining may inform risk stratification for low-grade squamous intraepithelial cervical lesions (CIN1). PMID: 27680604 the status of K7 expression in metastatic lymph nodes from colorectal carcinoma is a poor prognostic factor PMID: 28155971 Mismatch repair (MMR) defects influence the expression of clinically important biomarkers for endometrioid-type endometrial carcinoma as decreased cytokeratin 7 expression is more commonly associated with MMR deficiency. PMID: 25851713 Ischemic parenchymal changes are characterized by hepatocyte K7 immunoexpression PMID: 26887669 Survival analysis showed that the non-small cell lung carcinoma patients with enhanced expression of CK7, ELF3, EGFR, and EphB4 mRNA in peripheral blood leukocytes had poorer disease-free survival and overall survival than those without. PMID: 27827952 Keratin 34betaE12/K7 expression is a prognostic parameter in resected early stage NSCLC that allows identification of high-risk NSCLC patients with poor cancer-specific and overall survival. PMID: 26057535 K7 expression was also detected in 72 of 75 triple-negative carcinoma cases PMID: 26670478 CK7, TTF-1 and napsin A are predominantly expressed in primary lung adenocarcinoma patients, with CDX-2 being inconsistently expressed. PMID: 26469326 CK7 staining was notably heterogeneous, with 14.5% of all cases demonstrating PMID: 22748158 Data show that cytokeratin-7 (KRT7) mRNA expression serves as a sensitive approach for the molecular detection of KRT7-positive circulating tumour cells (CTCs)-resembling A549 cells in peripheral whole blood. PMID: 26306784 Cytokeratin 7 positivity in cervical low-grade squamous intraepithelial lesion is a marker for risk of progression to a high-grade lesion. PMID: 26551618 Immunostaining for CK7 and epithelial membrane antigen can be used to differentiate interlobular bile ducts from ductular proliferation in patients with cholestasis. PMID: 26366614 Epithelial-mesenchymal transition-related proteins CK-7 and alpha-SMA colocalized to the intrahepatic biliary epithelial cells in patients with biliary atresia. PMID: 25406900 The immunofluorescent staining pattern of Wnt1 and CK7 as well as Wnt1 and CK13 was consistent with IHC results. Thus, in pleomorphic adenoma, Wnt is involved in tumor cell differentiation of peripheral columnar cells forming solid nests PMID: 25076852 The present study confirmed that CK14, but not CK20 or CK7, is expressed in urothelial carcinoma with squamous differentiation and squamous cell carcinoma of the urinary bladder. PMID: 25643514 Our results suggested that a combination of CK7 and TP53 immunohistochemistry may be helpful in diagnosing inflammatory bowel disease-associated dysplasia in difficult cases. PMID: 23887291 BRAF-mutated microsatellite stable colorectal carcinoma often displays reduced CDX2 and increased CK7 expression PMID: 24908142 Loss of cytokeratin 7 is associated with reduced response to concommitant radiochemotherapy for locally advanced cervical cancer. PMID: 24403459 CK7 and Cam 5.2 expression may occur in SCC. A panel including Ber-Ep4 is advisable for immunohistochemical differentiation of EPD from SCC. PMID: 23590728 Of the cases of clear cell renal carcinoma there was immunoreactivity for alpha-methylacyl-CoA racemase and strong diffuse immuno-positivity for cytokeratin. PMID: 23434146 CK7 + centrilobular hepatocytes occur relatively frequently in non-neoplastic liver disease, associated with centrilobular scarring and CK7-positive periportal hepatocytes, and appear to be a non-specific phenomenon of underlying disease. PMID: 22716237 Heterogeneity of cytokeratin 7 expression in pagetoid Bowen's disease. PMID: 22390404 Pouch/peripouch and UC-associated adenocarcinoma had a comparable positive rate for CK7, CK20, and CDX2 by immunohistochemistry. PMID: 22895272 High Cytokeratin-7 is associated with esophageal squamous cell carcinoma. PMID: 22203179 Both the CK7-/CK20+ phenotype and expression of the antibody CDX2 are highly specific and sensitive markers of colorectal origin. PMID: 22268990 This is the first reported study of the relationship between CK20/CK7 immunophenotype, BRAF mutations and microsatellite status in colorectal carcinomas PMID: 22361037 None of the Wilms' tumors-associated lesions were positive for KRT7, but 69-80% of lesions associated with pRCpapillary renal cell tumors and mucinous tubular and spindle cell carcinomas were positive for KRT7. PMID: 22382985 The expressions of CK7 and CK20 in nasal polyps were analyzed. PMID: 22119824 Aberrant expression of K7 in budding cancer cells represents a modification of the epithelial phenotype ('epithelial-epithelial transition': EET) which may be linked to gains in motility and invasive potential. PMID: 21884201 CK-7 expression grades correlated positively with histological stages of primary biliary cirrhosis (r=0.639, P<0.000) and negatively with granulomas (r=-0.432, P<0.0001; OR=0.173, P=0.0011). PMID: 21681009 Our results reveal that menopause influences the adipose tissue expression of many genes, especially of neurexin 3, metallothionein 1E, and keratyn 7, which are associated with the alteration of several key biological processes. PMID: 21358552 Our results along with the data from the literature indicate that CK7/CK20 expression may be of clinical significance. PMID: 21574103 Case Report: Primary pulmonary adenocarcinoma with enteric differentiation resembling metastatic colorectal carcinoma, negative for cytokeratin 7. PMID: 20727680 A considerable number of colorectal carcinomas showed immunoreactivity to CK7. PMID: 21282015 Hepatocyte CK7 expression is frequently noted in chronic allograft rejection, and it would appear to reflect ductopenia. PMID: 21228364 Immunohistochemistry for cytokeratins 7 and 19, which mark biliary epithelium, is helpful in the diagnosis of biliary diseases. PMID: 20538416 Endometrial adenocarcinomas show micro-anatomical variations in Ki67 expression and this is often inversely correlated with CK7 immunoreactivity. PMID: 20557372 Case Report: CK7+/CK20- Merkel cell carcinoma presenting as inguinal subcutaneous nodules with subsequent epidermotropic metastasis. PMID: 20574624 the expression of Cytokeratins 7, 8, 18, and 19 may serve as differential diagnostic markers for pulmonary large cell neuroendocrine carcinoma and small cell lung carcinoma PMID: 20398190 CK7 is a possible marker for colorectal carcinogenesis. PMID: 17715023 FOXA1 induces not only KRT7 but also LOXL2 in a subset of poor prognostic esophageal squamous cell carcinomas with metastatic lymph nodes PMID: 20043065 Toker cells and mammmary Paget cells share immunoreactivity to CK7. PMID: 20001343 Changing pattern of cytokeratin 7 and 20 expression from normal epithelium to intestinal metaplasia of the gastric mucosa and gastroesophageal junction PMID: 11962749 HPV16 E7 mRNA-cytokeratin 7 binding in squamous cervical cancer SiHa cells occurs through the 6-mer peptide SEQIKA present in human cytokeratin 7 protein PMID: 12072504

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.