Recombinant Human Keratin, Type Ii Cytoskeletal 7 (KRT7) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03956P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Keratin, Type Ii Cytoskeletal 7 (KRT7) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03956P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Keratin, Type Ii Cytoskeletal 7 (KRT7) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P08729 |
| Target Symbol | KRT7 |
| Synonyms | CK 7; CK-7; CK7; Cytokeratin 7; Cytokeratin-7; D15Wsu77e; K2C7; K2C7_HUMAN; K7; Keratin 7; Keratin 7; type II; Keratin type II cytoskeletal 7; Keratin; 55K type II cytoskeletal; Keratin; simple epithelial; Keratin; simple epithelial type I; K7; Keratin; type II cytoskeletal 7; Keratin-7; Krt2-7; KRT7; MGC11625; MGC129731; MGC3625; Sarcolectin; SCL; Type II mesothelial keratin K7; Type-II keratin Kb7 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD |
| Expression Range | 2-469aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 67.3kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7). |
| Subcellular Location | Cytoplasm. |
| Protein Families | Intermediate filament family |
| Database References | HGNC: 6445 OMIM: 148059 KEGG: hsa:3855 STRING: 9606.ENSP00000329243 UniGene: PMID: 30194170 |
