Recombinant Human Keratin, Type I Cytoskeletal 10 (KRT10) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08175P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Keratin, Type I Cytoskeletal 10 (KRT10) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08175P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Keratin, Type I Cytoskeletal 10 (KRT10) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P13645 |
| Target Symbol | KRT10 |
| Synonyms | BCIE; BIE; CK 10; CK-10; Cytokeratin-10; EHK; K10; K1C10_HUMAN; Keratin 10; Keratin 10 type I; Keratin; Keratin type i cytoskeletal 10; Keratin type I cytoskeletal 59 kDa ; Keratin-10; Keratin10; KPP; KRT10; type I cytoskeletal 10 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | EQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLE |
| Expression Range | 326-443aa |
| Protein Length | Partial |
| Mol. Weight | 15.7kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays a role in the establishment of the epidermal barrier on plantar skin.; (Microbial infection) Acts as a mediator of S.aureus adherence to desquamated nasal epithelial cells via clfB, and hence may play a role in nasal colonization.; (Microbial infection) Binds S.pneumoniae PsrP, mediating adherence of the bacteria to lung cell lines. Reduction of levels of KRT10 keratin decrease adherence, overexpression increases adherence. Neither protein has to be glycosylated for the interaction to occur. |
| Subcellular Location | Secreted, extracellular space. Cell surface. |
| Protein Families | Intermediate filament family |
| Database References | HGNC: 6413 OMIM: 113800 KEGG: hsa:3858 STRING: 9606.ENSP00000269576 UniGene: PMID: 28944608 |
