Recombinant Human Kallikrein-7 (KLK7) Protein (GST)

Name: Recombinant Human Kallikrein-7 (KLK7) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-10795P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Kallikrein-7 (KLK7) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P49862
Target Symbol	KLK7
Synonyms	Chymotryptic stratum corneum; hK 7; hK7; hSCCE; Kallikrein 7 (chymotryptic stratum corneum); Kallikrein related peptidase 7; Kallikrein-7; Kallikrein7; KLK 7; Klk7; KLK7_HUMAN; Protease serine 6; PRSS 6; PRSS6; SCCE; Serine protease 6; Signal protein; Stratum corneum chymotryptic enzyme
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	DKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Expression Range	28-253aa
Protein Length	Partial
Mol. Weight	51.7kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-\|-Gln-15' and insulin B chain at '6-Leu-\|-Cys-7', '16-Tyr-\|-Leu-17', '25-Phe-\|-Tyr-26' and '26-Tyr-\|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.
Subcellular Location	Secreted. Note=In ovarian carcinoma, secreted and also observed at the apical membrane and in cytoplasm at the invasive front.
Protein Families	Peptidase S1 family, Kallikrein subfamily
Database References	HGNC: 6368 OMIM: 604438 KEGG: hsa:5650 STRING: 9606.ENSP00000375683 UniGene: PMID: 28636767 KLK7 is differentially expressed in lesional biopsy specimens from patients with atopic eczema relative to normal skin PMID: 28479159 impaired KLK7 secretion from lamellar granules and increased LEKTI expression could underlie the insufficient activation of KLK in atopic dermatitis. PMID: 27769847 Epigenetic regulation of KLK7 gene expression in pancreatic and cervical cancer cells PMID: 27279059 Korean X-linked ichthyosis patients exhibited unimpaired skin barrier function and frequent association with the KLK7 gene polymorphism, which may differentiate them from Western X-linked ichthyosis patients. PMID: 27478344 This report demonstrates that concurrent loss of KLK5 and KLK7 associates with a poor clinical outcome in Squamous-Cell Carcinoma and could therefore serve as prognostic marker in this disease. PMID: 26022646 Data demonstrate that elevated levels of KLK6, KLK7 and KLK9 proteins are associated with poor glioblastoma patients survival. PMID: 26231762 Our findings suggest that serum KLK7 may be a valuable diagnostic biomarker for cervical cancer, and may help to determine the individual prognosis of these patients. PMID: 25182706 KLK6 and KLK7 mRNA and protein overexpression is directly associated with early-stage ovarian tumors. PMID: 25477184 Proteolytic cleavage of midkine, CYR61, and tenascin-C govern the pathophysiological roles of KLK7. PMID: 26032414 Early-stage oral squamous cell carcinoma and high KLK7 mRNA levels were correlated with the rs10581213(wt/ins + ins/ins) genotypes PMID: 23413953 These results demonstrate the aberrant expression of KLK7 in colon cancer cells and tissues and its involvement in cell proliferation in vitro and in vivo. PMID: 25153388 Daata indicate that the peptide Abz-NLY( downward arrow)RVE-Q-EDDnp is the best synthetic substrate for Kallikrein-related peptidase 7 (KLK7) [kcat/Km=455 (mMs)(-1)]. PMID: 25448018 KLK7 and KLK14 gene expression can be regarded as markers of poor prognosis for colorectal cancer patients with discriminating power between CC and adenoma patients. PMID: 23224034 Prochemerin processing protease converts prochemerin into active chemerinF; the activating truncation by the protease may trigger a structural C-terminal rearrangement leading to increased affinity of chemerin to chemokine-like receptor (CMKLR)1. PMID: 23495698 High KLK7 expression is associated with pancreatic ductal adenocarcinoma. PMID: 22573795 regulation of procaspase-14 maturation during terminal differentiation is a unique two-step process involving KLK7 and an activation intermediate of caspase-14. PMID: 22825846 The enhancement of protease activity through increased KLK7 expression by the TH2 cytokines IL-4 and IL-13 might be an important factor for mechanical and chemical epidermal barrier dysfunction in patients with atopic dermatitis. PMID: 22521249 Stromal cells can suppress the expression of the KLK7 gene in the epithelial cells in benign prostate hyperplasia. PMID: 21548205 Significant co-expression of KLKs 5 and 7 was observed in the same cancer samples. Increased KLK5 expression was a statistically significant independent prognostic factor for DFS and OS of patients PMID: 21868565 Both KLK7 (P=0.026) and KLK11 (P<0.001) expressions were decreased in prostate cancer cells compared to normal/benign prostate cells PMID: 21520985 KLK7 may play an important role in the activation of MMP-9 in tumors that express high levels of both these proteases PMID: 21616098 Our evidence suggests that the AACCins5874 insertion in the 3'untranslated region of the SCCE gene causes an over-expression in COS-7 and HeLa cells but does not have an effect on mRNA stability. PMID: 21168996 in the high-KLK7-expression group there was more progressive liver metastasis and more advanced clinical staging compared with the low-KLK7-expression group PMID: 20544292 hK7 plays an important role in mediating prostate cancer progression PMID: 20944116 Overexpression of kallikrein 7 is associated with cervical neoplasia. PMID: 19921697 expression and activity of KLK are under fine control and can be distinctly influenced by variables such as differentiation, calcium, vitamin D, and retinoic acid PMID: 20090765 High expression of KLK7 transcript with a long 3'-untranslated region is associated with ovarian cancer PMID: 12738725 human kallikrein 7 may have a role in breast carcnoma PMID: 14691584 Among all kallikreins measured, detectable levels in cerebrospinal fluid are identified for kallikrein K7. The most notable difference is seen between controls and frontotemperol dementia patients and controls and Alzheimer patients. PMID: 14972646 SCCE directly cleaved corneodesmosin and desmocollin 1 but was unable to degrade desmoglein 1. PMID: 15140227 The AACC insertion in the SCCE gene may result in a change to SCCE activity within the skin barrier so SCCE could have an important role in the development of atopic dermatitis. PMID: 15191543 Squamous cervical cancer expressed high levels of SCCE, suggesting that this protease may play an important role in invasion and metastasis. PMID: 15297163 in normal skin the LG system transports and secretes LEKTI earlier than KLK7 and KLK5 preventing premature loss of stratum corneum integrity/cohesion. PMID: 15675955 variability in KLK5 and KLK7 gene expression might be involved in lung tumorigenesis PMID: 15766562 in majority of patients with Netherton syndrome, Dsg1 & Dsc1 were reduced in living layers of epidermis; SCTE-like & SCCE-like activities were increased, suggesting these proteases participate in premature degradation of corneodesmosomal cadherins PMID: 16628198 KLK5 and KLK7 were shown to control activation of CAP18 and also influence further processing to smaller peptides with alternate biological activity; the balance of proteolytic activity at an epithelial interface will control innate immune defense PMID: 17012259 x-ray structures of recombinant active K7 at medium and atomic resolution PMID: 17909180 in 99 children and adults with atopic dermatitis found that an association with KLK7 4bp insertion polymorphism was not confirmed. PMID: 17989887 predominant localisation of KLK5 and KLK7 in acinar cells of the exocrine pancreas; KLK5 and KLK7 generate transcripts in pancreas variant from those in skin or ovary PMID: 18163887 Expression of KLK7, a novel biomarker for advanced ovarian carcinoma, was determined by a novel in situ quantitative method. PMID: 18325919 Data show that hK7 was crystallized, and its three-dimensional structure was solved in the absence of protease inhibitors. A model of the interaction between the protease and its inhibitor is proposed. PMID: 18329042 KLK7 is able to cleave fibronectin in a time-dependent manner, but not laminin. PMID: 18343220 KLK7 insertion appears to confer no risk of eczema; no interaction between the SPINK5 risk allele or the putative KLK7 risk allele and FLG mutations was found PMID: 18774391 Expression of kallikrein 7 diminishes pancreatic cancer cell adhesion to vitronectin and enhances urokinase-type plasminogen activator receptor shedding. PMID: 18953252 hK7 and ALP were decreased in malignant prostate epithelium. PMID: 18976018 kallikreins 5, 7, 8, and 10 are abundantly expressed in human OSCC and may be implicated in malignant progression PMID: 19085836 expression of K7 in BxPC-3 cells resulted in increase in shedding of soluble desmoglein 2 consistent with notion that aberrant expression of K7 in pancreatic tumors may result in diminished cell adhesion & facilitate tumor cell invasion PMID: 19091121 reduced expression of LEKTI and increased expression of SCCE and SCTE in human epidermal keratinocytes after UVB irradiation may contribute to desquamation of the stratum corneum. PMID: 19118981 Data suggest that KLK7 gene is up-regulated in colon cancer and its expression predicts poor prognosis for colon cancer patients. PMID: 19350120

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.