Recombinant Human Kallikrein-2 (KLK2) Protein (His)

Beta LifeScience SKU/CAT #: BLC-02885P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Kallikrein-2 (KLK2) Protein (His)

Beta LifeScience SKU/CAT #: BLC-02885P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Kallikrein-2 (KLK2) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P20151
Target Symbol KLK2
Synonyms Glandular kallikrein 2; Glandular kallikrein-1; hGK 1; hGK-1; hK2; Kallikrein 2 prostatic; Kallikrein related peptidase 2; kallikrein, glandular; Kallikrein, prostatic; Kallikrein-2; KLK 2; Klk-2; Klk2; KLK2_HUMAN; KLK2A 2; KLK2A2; MGC12201; Tissue kallikrein 2; Tissue kallikrein-2; Ton
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Expression Range 25-261aa
Protein Length Full Length of Mature Protein
Mol. Weight 30.2kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Protein Families Peptidase S1 family, Kallikrein subfamily
Database References

HGNC: 6363

OMIM: 147960

KEGG: hsa:3817

STRING: 9606.ENSP00000313581

UniGene: PMID: 26582203

  • The results indicated that W-hK2 had a defect in cellular trafficking due to its misfolding and that it activated the unfolded protein response, suggesting a mechanism to explain the association of the T allele with higher prostate cancer risk. PMID: 25847286
  • miR-378 was predicted to target both KLK2 and KLK4 and downregulated levels detected in prostate cancer patients. PMID: 25153390
  • The differential regulation of alternative transcripts (using KLK2, KLK3 and KLK4 as models) by androgens and anti-androgens as an indicator of prostate cancers, was investigated. PMID: 25153393
  • Structure-function analyses of KLK2 establish the 99-loop as master regulator of its activity. PMID: 25326387
  • Predictions based on levels of four kallikrein markers, including KLK2, in blood distinguish between pathologically insignificant and aggressive disease after radical prostatectomy with good accuracy. PMID: 23683475
  • Alteration of cellular junctions in benign prostatic hyperplasia could contribute to the presence of luminal epithelial secreted proteins prostate specific antigen (PSA)2 and and KLK2 in the stromal compartment. PMID: 24711254
  • we present the first evidence that KLK2 can also function as an androgen receptor modulator that may modulate cell growth after the development of castration-resistant prostate cancer PMID: 24122203
  • Associations observed in young, healthy men between the seminal plasma and serum concentrations of hK2 and PSA and several genetic variants in KLK2 and KLK3 could be useful to refine models of PSA cutoff values in prostate cancer testing. PMID: 24270797
  • Genetic variants at ATF7IP and KLK2 contribute to the variance of %fPSA. PMID: 23359319
  • Two SNPs, in beta-microseminoprotein at and in kallikrein-related peptidase 2 at, are associated with PCA3 score at genome-wide significance level PMID: 23555189
  • TK promotes vessel growth by increasing the number of EPCs and enhancing their functional properties through the kinin B(2) receptor-Akt signaling pathway. PMID: 22435954
  • An exploratory study of a KLK2 polymorphism as a prognostic marker in prostate cancer was found to be less likely associated with low Gleason score morphology. PMID: 21178268
  • we identifiedand genotyped novel single-nucleotide polymorphisms in cancer cases and controls which verified prior associations in KLK2 and in MSMB (but not in KLK3) with prostate cancer PMID: 20424135
  • Data show six non-synonymous amino acid or frame shift changes in the KLK3 gene and three changes in each of the neighboring genes, KLK15 and KLK2. PMID: 19823874
  • The identification of unusual mRNA splice variants of the KLK2 and KLK3 genes that result from inclusion of intronic sequences adjacent to the first exon. PMID: 11834722
  • Characterization of androgen receptor and nuclear receptor co-regulator expression in human breast cancer cell lines exhibiting differential regulation of kallikreins 2 and 3. PMID: 12124798
  • kallikrein expression in nipple aspirate fluid- ethnic variation PMID: 12209605
  • Measurements of free prostate specific antigen and hK2 improve on our ability to counsel patients prior to treatment as to their risk of biochemical recurrence PMID: 16152616
  • An additional serum marker for the detection of prostatic cancer. PMID: 16388506
  • a role for the KLK2 gene in prostate cancer susceptibility PMID: 17085659
  • results imply that prostate cancer risk is associated with androgen receptor(AR)-CAG repeat and kallikrein-2 polymorphisms in Indian population but no unambiguous association was observed with PSA and AR-GGN repeat polymorphism PMID: 17257635
  • role of kallikrein gene 2 and 3 variant SNPs in the etiology of prostate cancer among men of European ancestry PMID: 17593395
  • %fPSA and hK2 add important predictive value in older men and much closer to diagnosis PMID: 17657743
  • The two novel ETV4 fusion partners possess as predominant common characteristics androgen-induction and prostate-specific expression. PMID: 18451133
  • Recombinant hK2 activates ERK1/2 signaling of prostate cancer cell lines, which express both PAR1 and PAR2. PMID: 18567807
  • adding free PSA and human kallikrein 2 to standard pretreatment risk-assessment models to predict biochemical recurrence after radical prostatectomy for prostate cancer enhanced the AUC PMID: 19003994
  • PSA and kallikrein 2 transcripts in the peripheral blood of prostate cancer patients during barchytherapy could serve as a predictor of biochemiacl outcome. PMID: 19434652
  • Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator) PMID: 19223501
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed