Recombinant Human Kallikrein-10 (KLK10) Protein (His)

Name: Recombinant Human Kallikrein-10 (KLK10) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08293P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Kallikrein-10 (KLK10) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O43240
Target Symbol	KLK10
Synonyms	Breast normal epithelial cell associated serine protease; Kallikrein related peptidase 10; Kallikrein-10; Kallikrein10; KLK 10; KLK10; KLK10_HUMAN; NES 1; NES1; Normal epithelial cell specific 1; Normal epithelial cell-specific 1; Protease serine like 1; Protease serine-like 1; PRSS L1; PRSSL 1; PRSSL1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIR
Expression Range	31-274aa
Protein Length	Partial
Mol. Weight	30.8kDa
Research Area	Cell Cycle
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Has a tumor-suppressor role for NES1 in breast and prostate cancer.
Subcellular Location	Secreted.
Protein Families	Peptidase S1 family, Kallikrein subfamily
Database References	HGNC: 6358 OMIM: 602673 KEGG: hsa:5655 STRING: 9606.ENSP00000311746 UniGene: PMID: 29807015 blockade of KLK10 attenuates epithelial-mesenchymal transition and activation of FAK-SRC-ERK signaling, which explains the mechanism of KLK10 in promoting metastasis. PMID: 29621546 To the best of our knowledge, this is the first report on KLK10 exon 3 unmethylated PCR product concentration as potential early epigenetic diagnostic marker in primary ovarian tumors. PMID: 29690914 KLK10 was verified to be a potential therapeutic target for reversing trastuzumab resistance in breast cancer cells. PMID: 27825132 Pronounced correlations between KLK10/KLK11 (rs = 0.647) and between KLK9/KLK15 (rs = 0.716) mRNA, but not between other combinations, indicate coordinate expression of distinct pairs of peptidases PMID: 29095848 identification and molecular cloning of eight novel transcripts of the human KLK10 gene using 3' rapid amplification of cDNA ends (3' RACE) and next-generation sequencing (NGS), as well as their expression analysis in a wide panel of cell lines, originating from several distinct cancerous and normal tissues PMID: 28419837 Data suggest that mature KLK9 (kallikrein 9) is a glycosylated chymotrypsin-like enzyme with strong preference for tyrosine over phenylalanine at P1 cleavage position; substrate specificity of KLK9 appears to extend to KLK10 and midkine; enzyme activity is enhanced by Mg2+ and Ca2+, but is reversibly attenuated by Zn2+; KLK9 is inhibited in vitro by many naturally occurring or synthetic protease inhibitors. PMID: 28559305 KLK10 potentially plays a crucial role in esophageal cancer cell growth. PMID: 26479703 KLK10 may function as a tumour suppressor by repressing proliferation, enhancing apoptosis and decreasing glucose metabolism in PC3 cells. PMID: 26616394 treated and untreated prolactin-producing pituitary adenomas and carcinomas as well as TSH-producing pituitary adenomas and carcinomas were conclusively immunopositive for KLK10 PMID: 25553760 Immunoexpression of KLK10 in the ACTH-secreting tumors as well as in the Crooke cell tumors was significantly increased when compared with the nonfunctioning tumors and in the corticotrophs of non-tumorous pituitaries. PMID: 25517869 is the first correlation of oral squamous cell carcinoma with KLK10 rs3745535G>T polymorphisms PMID: 23413953 KLK10 expression is an independent biomarker of unfavorable prognosis in patients with gastric cancer. PMID: 24409072 Patients with high KLK10 expression had a shorter disease-free and overall survival rates. PMID: 23499583 Enhancing KLK10 gene expression can decrease the proliferation and invasiveness of human tongue cancer cells in vitro. PMID: 23268413 Finding lower KLK10 levels in pleomorphic adenoma suggests aberrant expression in a tumour that develops primarily from myoepithelial cells. A kallikrein cascade may play a role in the development and/or outcome of some salivary gland tumours. PMID: 23250777 KLK10 DNA methylation was significantly associated with prostate cancer. PMID: 22874102 Data indicate a statistically significant positive association between kallikrein-related peptidase 10 (KLK10) and tumor stage and liver metastases. PMID: 22437349 Loss of KLK10 is associated with ovarian cancer. PMID: 22102857 KLK10 gene expression may be used as a marker of unfavorable prognosis for colorectal cancer PMID: 21487810 Single nucleotide polymorphisms in KLK10 is not associated with ovarian cancer. PMID: 20686372 Results indicate that cells underwent EMT exhibited overactive TGFbeta signaling and loss of expression of the CDH1, CGN, CLDN4, and KLK10 genes as a result of hypermethylation of their corresponding promoter regions. PMID: 20086175 NES1/kallikrein 10 mRNA is expressed in normal breast tissue and benign lesions, with loss of NES1/kallikrein 10 expression during tumor progression. PMID: 11705853 Identification of single nucleotide polymorphisms in the human kallikrein 10 (KLK10) gene and their association with prostate, breast, testicular, and ovarian cancers. PMID: 11920956 Higher expression in breast cancer predicts tamoxifen resistance PMID: 12087468 kallikrein 10 is expressed in the nonmalignant and malignant prostate, with cancer tissues demonstrating slightly lower expression PMID: 12970725 Downregulation of kallikrein 10 is associated with breast cancer PMID: 14696124 Kallikrein K10 is decreased in cerebrospinal fluid (CSF) of frontotemporal dementia patients and K10 is increased in CSF of Alzheimer patients, compared to control subjects. PMID: 14972646 new splice variants of the KLK10 gene identified; in silico analyses show differential expression of gene in various malignancies and provide basis for directing experimental efforts to investigate possible role of gene as cancer biomarker PMID: 16103744 CpG island hypermethylation plays an important role in the downregulation of kallikrein 10 mRNA and protein expression PMID: 16254462 Kallikrein 10 is highly expressed in uterine serous papillary carcinoma, and it is released in the plasma and serum of uterine serous papillary carcinoma patients. PMID: 16647913 REVIEW of KLK10 gene expression in neoplasm cells PMID: 16800732 functional importance of retinoic acid response elements in the hK10 promoter was demonstrated by retinoid induction of hk10 promoter-reporters PMID: 16800735 results suggest a co-regulation of KLK10 and KLK11 expression in lung and a lack of KLK10 suppressor role in non-small-cell lung cancer PMID: 16800740 KLK10 expression is up-regulated in CRC and GC and higher expression of KLK10 closely correlates with advanced disease stage, which predicts a poorer prognosis. PMID: 16928223 Results suggest that NES1 inactivation might contribute to the malignant progression of human gastric cancers. PMID: 17182177 Glucocorticoid receptor-mediated expression of kallikrein 10 PMID: 17937626 The hormone-specific upregulation of PSA, KLK10 and KLK11 in the breast cancer cell line T47D is dependent on major intracellular signaling pathways. PMID: 18515984 Suppression of gastric cancer growth by baculovirus vector-mediated transfer of normal epithelial cell specific-1 gene. PMID: 18855978 synergistic effects between estrogens and androgens on estrogen-sensitive genes may have implications on the role of the kallikreins 10, 11, and 14 in associated risk of breast cancer and progression. PMID: 19383315 Down-Regulation of KLK10 through DNA Methylation is associated with hepatocellular carcinoma. PMID: 19760608

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.