Recombinant Human Junctional Adhesion Molecule B (JAM2) Protein (His)

Name: Recombinant Human Junctional Adhesion Molecule B (JAM2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10779P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Junctional Adhesion Molecule B (JAM2) Protein (His) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P57087
Target Symbol	JAM2
Synonyms	C21orf43; CD 322; CD322; CD322 antigen; JAM 2; JAM B; JAM IT/VE JAM; JAM; vascular endothelial; JAM-2; JAM-B; JAM2; JAM2_HUMAN; JAMB; Jcam2; Junction adhesion molecule 2; Junction adhesion molecule B; Junctional adhesion molecule 2; Junctional adhesion molecule B; PRO 245; PRO245; Vascular endothelial junction associated molecule; Vascular endothelial junction-associated molecule; VE JAM; VE-JAM; VEJAM
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
Expression Range	29-238aa
Protein Length	Extracellular Domain
Mol. Weight	27.5kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM3 to regulate different cellular processes. Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow. At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3. Plays a central role in leukocytes extravasation by facilitating not only transmigration but also tethering and rolling of leukocytes along the endothelium. Tethering and rolling of leukocytes are dependent on the binding by JAM2 of the integrin alpha-4/beta-1. Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation. Also functions as an inhibitory somatodendritic cue that prevents the myelination of non-axonal parts of neurons. During myogenesis, it is involved in myocyte fusion. May also play a role in angiogenesis.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Cell junction. Cell junction, tight junction.
Protein Families	Immunoglobulin superfamily
Database References	HGNC: 14686 OMIM: 606870 KEGG: hsa:58494 STRING: 9606.ENSP00000420419 UniGene: Hs.517227
Tissue Specificity	Highly expressed in heart, placenta, lung, foreskin and lymph node. Prominently expressed on high endothelial venules and also present on the endothelia of other vessels (at protein level). Also expressed in the brain in the caudate nuclei.

Gene Functions References

this review briefly focuses on what is currently known about the structure, function, and mechanism of JAM-B, with particular emphasis on cancer. [review] PMID: 27121546
JAM-2 may function as a putative tumour suppressor in the progression and metastasis of colorectal cancer PMID: 26782073
This study showed thatJAM2 (rs2829841; intronic), associated with Alzheimer disease. PMID: 25649652
Function of Jam-B/Jam-C interaction in homing and mobilization of human and mouse hematopoietic stem and progenitor cells. PMID: 24357068
These data brought new evidences for the role of JAM2 and JAM3 in progression of gastric adenocarcinoma PMID: 23277282
role as an adhesive ligand for interacting with a variety of immune cell types PMID: 11823489
interacts with alpha4beta1; Facilitation by JAM3 PMID: 12070135
Results suggest a role for junctional adhesion molecule-2 (JAM-2) in facilitating transmigration in endothelial cells PMID: 12476045
Examine JAM-2 expression in normal/inflammed lymphatic endothelium. PMID: 17822725
Discovery as ligand for the integrin alpha4beta1 PMID: 12070135
Cloning and discovery as adhesion receptor for T cells PMID: 10945976

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.