Recombinant Human Isoleucine--Trna Ligase, Cytoplasmic (IARS) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01706P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Isoleucine--Trna Ligase, Cytoplasmic (IARS) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01706P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Isoleucine--Trna Ligase, Cytoplasmic (IARS) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P41252 |
Target Symbol | IARS |
Synonyms | Isoleucyl-tRNA synthetase;IRS;IleRS |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | DRWILSFMQSLIGFFETEMAAYRLYTVVPRLVKFVDILTNWYVRMNRRRLKGENGMEDCVMALETLFSVLLSLCRLMAPYTPFLTELMYQNLKVLIDPVSVQDKDTLSIHYLMLPRVREELIDKKTESAVSQMQSVIELGRVIRDRKTIPIKYPLKEIVV |
Expression Range | 693-852aa |
Protein Length | Partial |
Mol. Weight | 26.3 kDa |
Research Area | Epigenetics And Nuclear Signaling |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA. |
Subcellular Location | Cytoplasm. Cytoplasm, cytosol. |
Protein Families | Class-I aminoacyl-tRNA synthetase family |
Database References | HGNC: 5330 OMIM: 600709 KEGG: hsa:3376 STRING: 9606.ENSP00000364794 UniGene: PMID: 27891590 |