Recombinant Human Islet Cell Autoantigen 1 (ICA1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10904P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Islet Cell Autoantigen 1 (ICA1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10904P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Islet Cell Autoantigen 1 (ICA1) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q05084 |
Target Symbol | ICA1 |
Synonyms | 69 kDa islet cell autoantigen; Diabetes mellitus type I autoantigen; ICA 1; Ica1; ICA69; ICA69_HUMAN; ICAp69; Islet cell autoantigen 1 (69kD); Islet cell autoantigen 1 69kDa; Islet cell autoantigen 1; Islet cell autoantigen 1 isoform; Islet cell autoantigen p69; OTTHUMP00000200933; OTTHUMP00000200934; OTTHUMP00000200941; OTTHUMP00000200993; p69 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK |
Expression Range | 1-268aa |
Protein Length | Partial |
Mol. Weight | 35.5kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May play a role in neurotransmitter secretion. |
Subcellular Location | Cytoplasm, cytosol. Golgi apparatus membrane; Peripheral membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Peripheral membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Peripheral membrane protein. Note=Predominantly cytosolic. Also exists as a membrane-bound form which has been found associated with synaptic vesicles and also with the Golgi complex and immature secretory granules. |
Database References | HGNC: 5343 OMIM: 147625 KEGG: hsa:3382 STRING: 9606.ENSP00000379908 UniGene: PMID: 24358315 |