Recombinant Human Interleukin-9 (IL9) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05344P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Interleukin-9 (IL9) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05344P
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, High-purity interleukins & receptors for research, High-quality cytokines for advanced research, High-quality recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Interleukin-9 (IL9) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined in a cell proliferation assay using MO7e human megakaryocytic leukemic cells is typically less than 0.5 ng/ml |
| Uniprotkb | P15248 |
| Target Symbol | IL9 |
| Synonyms | Cytokine P40; Homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; IL-9; Il9; IL9_HUMAN; Interleukin 9; Interleukin-9; Mast cell growth factor; MCGF; Megakaryoblast growth factor; P40; p40 cytokine; p40 T cell and mast cell growth factor ; T cell growth factor 3 ; T cell growth factor p40 ; T-cell growth factor P40; TCGF 3 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-6His |
| Complete Sequence | QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI |
| Expression Range | 19-144aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 15.16 kDa |
| Research Area | Immunology |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Supports IL-2 independent and IL-4 independent growth of helper T-cells. |
| Subcellular Location | Secreted. |
| Protein Families | IL-7/IL-9 family |
| Database References | HGNC: 6029 OMIM: 146931 KEGG: hsa:3578 STRING: 9606.ENSP00000274520 UniGene: PMID: 29927662 |
