Recombinant Human Interleukin-9 (IL9) Protein (His), Active

Name: Recombinant Human Interleukin-9 (IL9) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05344P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, High-purity interleukins & receptors for research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Interleukin-9 (IL9) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined in a cell proliferation assay using MO7e human megakaryocytic leukemic cells is typically less than 0.5 ng/ml
Uniprotkb	P15248
Target Symbol	IL9
Synonyms	Cytokine P40; Homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; IL-9; Il9; IL9_HUMAN; Interleukin 9; Interleukin-9; Mast cell growth factor; MCGF; Megakaryoblast growth factor; P40; p40 cytokine; p40 T cell and mast cell growth factor ; T cell growth factor 3 ; T cell growth factor p40 ; T-cell growth factor P40; TCGF 3
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His
Complete Sequence	QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Expression Range	19-144aa
Protein Length	Full Length of Mature Protein
Mol. Weight	15.16 kDa
Research Area	Immunology
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Supports IL-2 independent and IL-4 independent growth of helper T-cells.
Subcellular Location	Secreted.
Protein Families	IL-7/IL-9 family
Database References	HGNC: 6029 OMIM: 146931 KEGG: hsa:3578 STRING: 9606.ENSP00000274520 UniGene: PMID: 29927662 IL9 CNS-25/IL9 CNS-18 is a critical and conserved regulatory element for IL-9 production in mice and humans. PMID: 30442929 CXCL10, not CXCL9 or CXCL11, induced IL-9 expression in the liver tissue. PMID: 29860220 Our study reveals that degeneration and destruction of cartilage may be related to the production of IL-9 in osteonecrosis of the femoral head patients. In a human primary chondrocytes culture model, IL-9 increased the degeneration of cartilage; blocking JAK-STAT signaling alleviated this effect. PMID: 29775946 Having one or more copies of the 1635A allele was associated with increased cytomegalovirus acquisition in HIV-infected infants (42 vs. 11%, P = 0.03) and increased risk of Epstein-Barr virus acquisition in HIV-exposed uninfected infants (hazard ratio = 4.2, P = 0.02) compared with 1635GG. PMID: 29112074 T Helper 9 cells may be the major source of interleukin-9 (IL-9) in children with allergic asthma. In these patients, IL-9 impairs interferon gamma production and synergistically promotes interleukin-4-induced IgE secretion. PMID: 28724400 Increased expression of nuclear factor of activated T cells 1 drives IL-9-mediated allergic asthma. PMID: 26993036 these results demonstrated that IL-9-expressing Th9 cells were upregulated in breast cancer patients and potentially possessed antitumor roles by enhancing CD8+ T cell-mediated cytotoxicity PMID: 28918288 Serum IL-9 and IL-22 are associated with eosinophilia in cow's milk allergy, and decrease in these two cytokines with occurs with cow's milk elimination. PMID: 28934137 The systemic IL9 level is higher in ulcerative colitis and corresponds with endoscopic inflammation, suggesting its possible application as a negative marker of mucosal healing. PMID: 28652656 These findings suggest that IL-9 is involved in the pathogenesis of VKH disease, and that IL-9 might also enhance the inflammatory response by increasing the secretion of IL-17, an established proinflammatory cytokine in VKH disease PMID: 28761327 Data suggest that the conditions defined for strong induction of interleukin-9 (IL-9) might be relevant for the development of Vdelta2 T-cell-based immunotherapy. IL-9 might be relevant for the development of Vdelta2 T-cell-based immunotherapy. PMID: 27791087 An aberrant expression profile of Th9/IL-9 was associated with pathogenesis of immune thrombocytopenia, possibly through cooperative interaction with Th17/IL-17. PMID: 27662073 In vitro data indicate that IL9 is regulated by STAT3/5 and in vivo results highlight the pro-neoplastic effect of IL9 on lymphoma T cells. The results suggest that IL9 and its regulators are promising new targets for therapy development in mycosis fungoides. PMID: 26851186 recent findings suggest that blockade of IL-9 signaling is effective in treating experimental models of autoimmune and chronic inflammatory diseases such as inflammatory bowel diseases, allergic disorders such as food allergy and asthma. PMID: 26976761 Findings showed that serum levels of IL-9 were elevated in diffuse large-B-cell lymphoma (DLBCL) patients and positive expression of IL-9 was correlated with adverse prognosis indicators. It directly effected proliferation and apoptosis of DLBCL cells by enhancing the expression of p21CIP1 genes and promoted tumor cells to display resistance to chemotherapeutic drugs. PMID: 27364124 no differences were found in serum levels of IL-9 between different clinical forms of periportal fibrosis in human Schistosoma mansoni infection in Brazil PMID: 27506138 PU.1 and IL-9 may play a role in AD pathogenesis and relate to disease severity and clinical eruption types. PMID: 28229452 Inflammatory cell expression of IL-9 and IL-17C were increased in chronic rhinosinusitis, particularly with allergy and asthma. These interleukins may contribute to the pathogenesis of chronic rhinosinusitis with nasal polyps as well as atopy and may serve as therapeutic targets for disease management PMID: 26989880 serum levels determined of both T cell polarizing (IL- 33 and IL-12) and T cell effector (IFN-gamma, IL-4, IL-10, IL-17 and IL-9) cytokines in T1DM (type-1 Diabetes Mellitus) subjects with and without microvascular complications (MVC). All the tested cytokines were significantly elevated in T1DM subjects except for IFN-gamma with no significant difference between those with and without MVC. PMID: 27442004 results suggest that Th9 cells and IL-9 could play an important role in the pathogenesis of systemic sclerosis by modulating adaptive and innate immune responses and the production of autoantibodies and indicate the IL-9 pathway as a possible therapeutic target PMID: 28681919 TL1A differentially induces expression of TH17 effector cytokines IL-17, -9, and -22 and provides a potential target for therapeutic intervention in TH17-driven chronic inflammatory diseases. PMID: 27733581 These data indicate that IL-9 is an essential regulator of megakaryopoiesis and a promising therapeutic agent for treatment of thrombocytopenia such as CIT. PMID: 28450306 Expression of IL-9 remarkably increases in peripheral blood and liver tissues in patients with primary biliary cirrhosis PMID: 27916102 IL-9 promotes proliferation and metastasis in pancreatic cancer cells; this effect may partly involve regulation of the miR-200a/b-catenin axis. PMID: 28349057 in PsA patients gammadelta T cells activation is driven prevalently by IL-9/IL-9R interaction, and not only by IL-23/IL-23R. Together these findings indicate gammadelta T cells and IL-9 as new players in the pathogenesis of PsA. PMID: 27543964 Th9 cells produce IL9 that may participate in pathogenesis of Takayasu's arteritis PMID: 27629397 IL-9 serum leves are elevated in patients with systemic lupus erythematosus, rheumatoid arthritis and systemic sclerosis but their clinical significance is unknown. [review] PMID: 26921642 Th9 cell numbers and IL-9 levels are correlated with OA patient symptoms and joint functionality PMID: 26926842 IL-9 is functionally active, and is a pro-growth/survival factor for the localized pathologic T cells in the synovium of inflammatory arthritis. PMID: 26751012 Asthmatic children showed an increase in plasma Il9 levels post Mycoplasma pneumoniae infection. PMID: 26191227 Interleukin-9 Is Associated with Elevated Anti-Double-Stranded DNA Antibodies in Lupus-Prone Mice PMID: 25902303 Data demonstrated increased serum levels of IL-9 in systemic lupus erythematosus and rheumatoid arthritis patients but no association with clinical and laboratory parameters was found. PMID: 26078482 identified as a gene target that might interact with environmental exposure to dust mite allergen to increase asthma severity in children PMID: 25913104 association between IL-9 and diabetic kidney disease was complex as it was reduced in diabetes mellitus, but it was of normal levels in those with diabetic kidney disease PMID: 25542095 secretion increased in respiratory epithelial adenomatoid hamartoma tissue PMID: 26131817 The results provide evidence that IL-9 is predominantly involved in the pathogenesis of ulcerative colitis suggesting that targeting IL-9 might become a therapeutic option for patients with UC. PMID: 24957265 Serum IL-9 is closely related to several clinical features, such as age, B symptoms and local lymph node involvement. It can also be an independent prognostic factor for extranodal NK/T-cell lymphoma, which suggests a role for IL-9 in disease pathogenesis PMID: 24722378 Upregulation of IL-9 induced by pSTAT6 may be involved in the pathogenesis of chronic lymphocytic leukemia. PMID: 24966942 IL-9 is a key component of memory TH cell peanut-specific responses from children with peanut allergy (PA) and may be a useful biomarker to distinguish between children with PA and those with peanut sensitization. PMID: 25112699 Overexpression of IL-9 may contribute to the pathogenesis of chronic lymphocytic leukemia and is associated with some adverse prognostic parameters. PMID: 24551294 This study demonstrates that IL-9, through its direct effects on Th1 and ability to promote IL-4 secretion, has a regulatory role for Th1 lymphocytes in allergic contact dermatitis. PMID: 24487305 A role for the IL-9/IL-9R axis in the atherosclerotic process, is reported. PMID: 24023645 IL-9 production by memory T-helper (TH)9 cells is higher in the peripheral blood of patients with asthma than in healthy donors. PMID: 24468256 Recruitment of interleukin 9-producing CD4+ T cells into malignant pleural effusion could be induced by pleural CCL20 and that the majority of Th9 cells in MPE displayed the phenotype of effector memory cells. PMID: 23700286 The activator protein 1 (AP1) family transcription factor BATF (B cell, activating transcription factor-like) was among the genes enriched in Th9 cells and was required for the expression of IL-9 and other Th9-associated genes. PMID: 24216482 the expansion of the Th9 cell subset, up-regulation of the PU.1 transcription factor and increased secretion of the IL-9 cytokine may contribute to the pathogenesis of AD PMID: 24032555 Higher numbers of TH9 cells occur in normal human skin & blood vs metastatic lesions of progressive stage IV melanoma. These results suggest a role for IL-9 in tumor immunity. PMID: 22772464 Children with atopic dermatitis may have higher serum IL-9 levels than healthy children, and IL-9 levels are significantly related to symptom severity. PMID: 22612419 Substantial renal IL-9 release was observed from deceased donor kidneys PMID: 22971662

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.