Recombinant Human Interleukin-8 (CXCL8) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01157P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Interleukin-8 (CXCL8) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01157P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Interleukin-8 (CXCL8) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P10145 |
| Target Symbol | CXCL8 |
| Synonyms | C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin;Granulocyte chemotactic protein 1 ;GCP-1Monocyte-derived neutrophil chemotactic factor ;MDNCFMonocyte-derived neutrophil-activating peptide ;MONAPNeutrophil-activating protein 1 ;NAP-1;Protein 3-10CT-cell chemotactic factor |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Expression Range | 23-99aa |
| Protein Length | Partial |
| Mol. Weight | 13.0 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. |
| Subcellular Location | Secreted. |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Database References | HGNC: 6025 OMIM: 146930 KEGG: hsa:3576 STRING: 9606.ENSP00000306512 UniGene: PMID: 29578433 |
