Recombinant Human Interleukin-8 (CXCL8) Protein (His), Active

Beta LifeScience SKU/CAT #: BLC-05324P
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SDS-PAGE.

Recombinant Human Interleukin-8 (CXCL8) Protein (His), Active

Beta LifeScience SKU/CAT #: BLC-05324P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Interleukin-8 (CXCL8) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 25 ng/mL.
Uniprotkb P10145
Target Symbol CXCL8
Synonyms (Ala-IL-8)77; (Ser-IL-8)72; 9E3; Beta thromboglobulin like protein; C-X-C motif chemokine 8; CEF-4; chemokine; CXC motif; ligand 8; CXCL8; Emoctakin; GCP-1; GCP/IL-8 protein I; GCP/IL-8 protein II; GCP/IL-8 protein III; GCP/IL-8 protein IV; GCP/IL-8 protein V; GCP/IL-8 protein VI; GCP1; Granulocyte chemotactic protein 1; IL-8; IL-8(1-77); IL-8(9-77); IL8; IL8/NAP1 form I; IL8/NAP1 form II; IL8/NAP1 form III; IL8/NAP1 form IV; IL8/NAP1 form V; IL8/NAP1 form VI; IL8_HUMAN; Inteleukin 8; LECT; LUCT; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF; MDNCF-b; MDNCF-c; MONAP; Monocyte derived neutrophil activating peptide; Monocyte derived neutrophil chemotactic factor; Monocyte-derived neutrophil chemotactic factor; Monocyte-derived neutrophil-activating peptide; NAF; NAP 1; NAP-1; NAP1; Neutrophil activating peptide 1; Neutrophil activating protein 1; Neutrophil-activating factor; Neutrophil-activating protein 1; Protein 3 10C; Protein 3-10C; SCYB 8; SCYB8; Small inducible cytokine subfamily B member 8; T cell chemotactic factor ; T-cell chemotactic factor; TSG 1; TSG1
Species Homo sapiens (Human)
Expression System Mammalian cell
Tag C-6His
Complete Sequence EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Expression Range 21-99aa
Protein Length Full Length of Mature Protein
Mol. Weight 10.1 kDa
Research Area Immunology
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Subcellular Location Secreted.
Protein Families Intercrine alpha (chemokine CxC) family
Database References

HGNC: 6025

OMIM: 146930

KEGG: hsa:3576

STRING: 9606.ENSP00000306512

UniGene: PMID: 29578433

  • High levels of LIFR in colorectal cancer (CRC) facilitated proliferation and migration of endothelial cells, resulting in an increase in angiogenic activity. Moreover, IL-8 was found to play a role in the LIFR induced angiogenesis. IL-8 levels were correlated with LIFR levels in CRC tissues, whereas depletion of IL-8 led to a reduced angiogenic activity of LIFR in CRC cells. PMID: 29751081
  • PKC-delta isoform plays a crucial role in Tat-TLR4 signaling pathway to activate NF-kappaB and CXCL8 production. PMID: 28539656
  • CXCL8 was a target of miR-204, and miR-204 suppression could not increase cell viability, migration, invasion, and EMT procedure when CXCL8 was silenced. PMID: 29402343
  • Interleukin 8 - 845 T/C and + 781 C/T polymorphisms were analyzed. For + 781C/T locus, in the dominant genetic model, significant difference between TT vs. CC + CT genotypes that significantly had a protective role against periodontitis disease. Positive association between distribution of IL8 - 845 T/C alleles and risk of periodontitis disease. C allele of IL-8 - 845 increased the risk of periodontitis disease. PMID: 30078118
  • These results suggest a direct involvement of IL-8-CXCR1/2 axes in GBM progression by promoting both cell proliferation and invasion and indirectly by promoting neovascularization in the form of vascular mimicry. PMID: 30086759
  • These results show that AKIP1 is crucial in cervical cancer angiogenesis and growth by elevating the levels of the NF-kappaB-dependent chemokines CXCL1, CXCL2, and CXCL8. PMID: 29520695
  • The extramembranous domain of HofQ (emHofQ) was shown to interact with various cytokines, of which IL-8 exhibited the strongest interaction. PMID: 30088437
  • he protein expression levels of IL-8 were significantly decreased in SZ patients, but no significant difference in the mRNA levels of IL-8 was observed between SZ patients and NC subjects. PMID: 28476335
  • immune system process is indispensable in the progression of disease in colon, and identifies that IL-8 and MMP-9 play potential critical roles for the progression. PMID: 30074183
  • IL-8 production was significantly enhanced following treatment with both IL-17A and CSE, while treatment with either IL-17A or CSE alone caused only a slight increase in IL-8 production. PMID: 29463070
  • Work identified IL-8 as a positive regulator of homotypic CIC formation via enhancing intercellular adhesion. PMID: 30021676
  • V2O5 induction of CXCL8 and CXCL11 chemokines may lead to the appearance and perpetuation of an inflammatory reaction into the dermal tissue. Further studies are required to evaluate dermal integrity and manifestations in subjects occupationally exposed, or living in polluted areas. PMID: 29901202
  • Study findings point out that PAR2 could play an essential role in gastroesophageal reflux disease (GERD) pathogenesis - even repeated short-term exposure to weakly acidic conditions lead to the upregulation of PAR2 and subsequent activation of the intense IL-8 release in the esophageal mucosa and initiation of mucosal immune response in GERD. PMID: 29672302
  • Given that IL-8, MIP-1beta, and MCP-1 are chemokines that play important roles in recruitment of immunocompetent cells for immune defense and tumor cell clearance, the observed lower levels of these markers with increasing PM2.5 exposure may provide insight into the mechanism by which DEE promotes lung cancer. PMID: 29023999
  • These results suggested that stemness induction in SKOV3 cells by macrophages co-cultured with SKOV3-derived OCSLCs involved IL-8/STAT3 signaling. PMID: 29656182
  • IL-8-251T>A (rs4073) Polymorphism is associated with gastric Cancer. PMID: 30275190
  • expression level of CXCL8 had a positive relationship with recurrence probability in Acute myeloid leukemia. PMID: 29596823
  • These data were in close agreement with the reduced cell migration and colony formation. Results from the present study suggested that reparixin and SCH527123 may be promising therapeutic agents for the treatment of pancreatic cancer by inhibiting the IL8/CXCR1/2 signaling cascade. PMID: 29749433
  • A urinary IL-8 level of less than 61.25 pg/ml is more sensitive for prediction of complete remission in idiopathic membranous nephropathy patients. PMID: 29415357
  • berberine inhibited the expression of MCP-1 and IL-8 induced by LPS. PMID: 28852897
  • Regarding the IL-8 promoter T - 251A, the TA and AA genotypes were associated with significantly decreased risks of nasopharyngeal carcinoma (NPC) in a Taiwanese population compared with the wild-type TT genotype. The mRNA and protein expression levels for NPC tissues revealed no significant associations among the 20 NPC samples with different genotypes. PMID: 30200105
  • IL-8 +781 T/C polymorphism is associated with the severe Clostridium difficile infection PMID: 29203364
  • ShRNA mediated down-regulation of CXCL8 resulted in inhibition of cell proliferation, viability and invasion in vitro and a near complete growth reduction of tumor in vivo. PMID: 29679563
  • CSF IL-8 concentrations were significantly elevated in CNS tumor patients as compared to non-tumoral individuals. AUC for CSF IL-8 was higher than for its index (CSF IL-8/serum IL-8). PMID: 29086194
  • High IL8 expression is associated with melanoma. PMID: 29286146
  • Lipo-CPFX, but not CPFX, retained the anti-IL-8 releasing activity. PMID: 29337216
  • The results indicate significant contribution of IL8 on survival of hormonal dependent early-stage breast cancer patients and association with established parameters such as estrogen receptors/progesterone receptor and HER2. PMID: 28569250
  • the frequency of non-classical monocytes expressing CXCL8 was increased in systemic sclerosis patient and monocytes expressing CXCL8 PMID: 29127442
  • ntermediate Molecular Mass Hyaluronan and CD44 interactions enhanced normal PMN phagocytosis and IL-8 production PMID: 28730511
  • serum levels in active vitiligo significantly elevated compared to those in stable vitiligo patients PMID: 29115683
  • High IL8 expression is associated with pancreatic adenocarcinoma. PMID: 29205349
  • Compared with controls, the interleukin (IL)-8 A/A genotype was more common in acute pancreatitis (AP). PMID: 29215544
  • The presence of neither the first transmembrane helix of the receptor nor the lipid bilayer significantly affected the interactions of IL-8 with Binding Site-I of CXCR1. PMID: 29143165
  • CXCL8 is highly expressed in cervical cancer tissues and cell lines, and correlated with malignant status and prognosis in cervical cancer patients. PMID: 28883082
  • In conclusion, to our knowledge, this is the first study in the association of rs4073 and rs2227306 polymorphisms with childhood asthma risk in the Tunisian population. PMID: 28993876
  • Results show that IL8 expression level is regulated by APE1 which activates NF-KB. PMID: 27388124
  • aberrant miR-520c-3p expression may lead to reduced IL-8 expression and promote the mesenchymal phenotype in breast cancer cells, thereby increasing invasive growth. PMID: 29048659
  • increased levels of IL-8 are associated with factors of worse prognosis in ovarian cancer PMID: 28872976
  • Significantly elevated blood levels of IL-8 in myelodysplastic syndrome patients. PMID: 28856536
  • the elevated concentrations of CXCL13, CXCL8, and CXCL10 or their increasing CSF/serum ratios may be potential biomarkers of neurosyphilis PMID: 27650493
  • Results implicated the important role of PRL-3 in glycolysis metabolism through improving IL-8 secretion in colorectal cancer cells, and PRL-3 mediated glycolysis contributed to the promotion of cancer metastasis. PMID: 28791350
  • Changes in serum IL-8 levels could be used to monitor and predict clinical benefit from immune checkpoint blockade in melanoma and NSCLC patients PMID: 28595336
  • Lung cancer patients showed significantly lower levels of serum VEGF (1.9 fold) and IL-8 (~9 fold) than COPD patients. VEGF level was significantly higher (2.6 fold) in metastatic than non-metastatic cancer patients. An increase in MMP-9 (~1.6 fold) levels was observed in lung cancer patients. PMID: 27811960
  • CXCL1/8 secreted by adipose-derived mesenchymal stem cells could promote breast cancer angiogenesis. PMID: 28514506
  • our meta-analysis suggests that the IL-8 rs4073, A2767T, T11722T2, rs2234671, rs2230054, rs1126579, rs2227306, rs2227307, rs2227532, and T-738A polymorphisms are not associated with periodontitis while the IL-8 C1633T and rs1126580 polymorphisms may elevate the susceptibility of periodontitis based on the currently available evidences. PMID: 28446725
  • An analogue of human CXCL8, CXCL8(3-72)K11R/G31P (hG31P) has been developed. PMID: 28754019
  • inflammation triggered property of Microcystin-LR via IL-8/CXCR2 signaling PMID: 29197248
  • A high IL-8 content in urine sampled on day 1 after renal transplantation was positively correlated with the activity of metalloproteinase-9 in urine. This proves that both of these chemokines cooperate in ischaemia-reperfusion injuries in transplanted kidneys. PMID: 28494217
  • We discovered that IL-8 secreted from decidual stromal cells is a key cytokine enhancing the invasiveness of trophoblasts PMID: 28328096
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed