Recombinant Human Interleukin-7 (IL7) Protein (His), Active

Beta LifeScience SKU/CAT #: BLC-05430P
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SDS-PAGE.

Recombinant Human Interleukin-7 (IL7) Protein (His), Active

Beta LifeScience SKU/CAT #: BLC-05430P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Interleukin-7 (IL7) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is less than 5 ng/ml.
Uniprotkb P13232
Target Symbol IL7
Synonyms IL7; Interleukin-7; IL-7
Species Homo sapiens (Human)
Expression System Mammalian cell
Tag C-6His
Complete Sequence DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Expression Range 26-177aa
Protein Length Full Length of Mature Protein
Mol. Weight 18.4 kDa
Research Area Immunology
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Subcellular Location Secreted.
Protein Families IL-7/IL-9 family
Database References

Gene Functions References

  1. Human IL-7 binds more strongly to stretched than to relaxed Fibronectin. PMID: 28845674
  2. Downregulation of IL-7 and T follicular helper cells (Tfh) might contribute to viral persistence in hepatitis C virus (HCV)infection. The in vitro study revealed an immunopotentiator of IL-7 in chronic HCV infection, which manifested as IL-7-regulated HCV-specific and nonspecific activated Tfh cells. PMID: 29672235
  3. These data indicate the involvement of IL-7 into a direct upregulation of growth and functional activity of human T cells in the absence of antigenic stimulus and the relative scarcity of costimulatory effects. PMID: 30193429
  4. these findings add further evidence that IL-7 is a key regulatory factor that may tune the balance between functionally different T-cell subsets following haematopoietic stem cell transplantation PMID: 29033080
  5. The constitutively signaling C7R system developed here delivers potent IL7 stimulation to CAR T cells, increasing their persistence and antitumor activity against multiple preclinical tumor models, supporting its clinical development PMID: 28830878
  6. we demonstrated that Imatinib mesylate (IM)impaired T cell survival through the inhibition of IL-7 and STAT5-p but not TCR signaling which remained unaffected during IM therapy. Thus, off-target inhibitory effects of IM on IL-7 and STAT5-p explain how T cell lymphopenia occurs in patients treated with IM. PMID: 28387753
  7. In this study, authors compared the concentrations of IL-15 and IL-7 in the plasma of MDS patients (n = 20) compared with that in the plasma of healthy controls (n = 20). PMID: 27036031
  8. Data strongly implicate IL-7 in the thymus-independent long-term survival of functional naive-Tregs. PMID: 26910841
  9. the critical role played by IL-7 and IL-15 in T cell homeostasis and how these cytokines could be used to improve immune reconstitution after allogeneic SCT. PMID: 26795458
  10. IL-7/IL-7R signaling pathway plays a possible role in recurrent pregnancy loss by upregulating Th17 immunity while downregulating Treg immunity. PMID: 27767237
  11. IL-7 inhibits the osteogenic differentiation of Periodontal ligament stem cells probably via inactivation of mitogen-activated protein kinase (MAPK) signaling pathway. PMID: 27579861
  12. this study shows that IL-7 restores T Lymphocyte immunometabolic failure in septic shock patients through mTOR activation PMID: 28724580
  13. In CRC, IL-7 was higher in patients with lymph node and distant metastases and with tumors located in right colon. In adenomas, IL-7 elevation was associated exclusively with villous growth pattern, while in IBD, circulating IL-7 reflected clinical activity of Crohn's disease and ulcerative colitis. PMID: 27866242
  14. Tuberculosis patients had lower soluble IL-7R and higher IL-7 plasma concentrations as compared to healthy contacts. PMID: 28582466
  15. CD56(bright) NK IL-7Ralpha expression negatively associates with HCV level, and IL-7-induced NK function is impaired during HCV and HIV infections PMID: 28400540
  16. IL-7 has a role inducing epitope masking of gammac protein in IL-7 receptor signaling complex PMID: 28127156
  17. Therefore, generalized CD8+ T-cell impairment in HCV infection is characterized, in part, by impaired IL-7-mediated signalling and survival, independent of CD127 expression. This impairment is more pronounced in the liver and may be associated with an increased potential for apoptosis. This generalized CD8+ T-cell impairment represents an important immune dysfunction in chronic HCV infection that may alter patient health. PMID: 27315061
  18. These results reveal a novel role of IL-7 and IL-15 in maintaining human T cell function, provide an explanation for T cell dysfunction in humanized mice, and have significant implications for in vitro studies with human T cells. PMID: 27855183
  19. The results show that SNPs in IL7 caused a significant association in this OA Chinese Han population. PMID: 27235388
  20. IL-7 is capable of enhancing functional T cell activity without causing significant functional inbalance between various T cell subsets. PMID: 28396296
  21. In summary, our study demonstrates that IL-7/IL-7R axis promotes the invasion and migration of prostate cancer cells, through activation of AKT/NF-kappaB pathway and upregulation of MMP-3 and MMP-7 expression PMID: 27611862
  22. review of role of IL-7 in immunity and its role in the pathogenesis of neoplasia [review] PMID: 28314253
  23. Indian patients with primary Sjogren's syndrome have higher salivary sL-selectin and IL-7 levels than healthy controls PMID: 27620619
  24. increased IL-7 was secreted by mesenchymal stem cells (MSC) in the bone marrow, which may protect leukemic cells from apoptosis induced by imatinib through JAK1/STAT5 signaling pathway PMID: 27272942
  25. The results from this study suggested for the first time that miR-181c was able to negatively regulate the production of proinflammatory cytokines IL-7 and IL-17 in myasthenia gravis patients. PMID: 25962782
  26. Increase in serum IL-7 is associated with adenoma. PMID: 25793917
  27. provides negative feedback on its own signaling in T cells via endocytosis and degradation of its receptor, CD127 PMID: 26272555
  28. Observed highly significant reductions in the concentration of circulating interleukin (IL)-16, IL-7, and Vascular Endothelial Growth Factor A (VEGF-A) in encephalomyelitis/chronic fatigue syndrome patients. PMID: 26615570
  29. The observations suggest that IL-7 may play a role in the pathogenesis of Graves' disease and may be associated with its clinical activity. PMID: 26113403
  30. IL-7 and SCF are elevated for a prolonged period after double umbilical cord blood transplantation and persistently high levels of these cytokines may correlate with worse clinical outcomes. PMID: 26177551
  31. IL7 was expressed primarily in the infundibulum and suprabulb of the hair follicle. IL7 expression was increased in cutaneous T-cell lymphoma. PMID: 26479922
  32. this study identified that IL-7, as well as the Akt/ mTOR signaling pathway, effectively modulates human Double-Negative T Cell- mediated suppression of allogeneic T cell responses. PMID: 26324773
  33. IL-7/IL-17 axis mediates chronic pelvic pain in experimental autoimmune prostatitis and in patients. PMID: 25933188
  34. In view of the important role IL-7 plays in lymphocyte proliferation, homeostasis and survival, down regulation of CD127 by Tat likely plays a central role in immune dysregulation and CD4 T-cell decline PMID: 25333710
  35. decreased IL-7 in peripheral blood, maybe, is a consequence of the negative feedback of the pro-inflammatory function in ITP patients. PMID: 24750122
  36. Septic patients showed the lowest levels of IL-7. Patients with severe sepsis reached levels of IL-7 higher than those observed in the groups of uncomplicated sepsis and septic shock. PMID: 25169828
  37. These observations provide evidence of a novel mechanism that enables cells to optimally use IL-7. PMID: 25870237
  38. blocking IL-7 in hMSCs-lymphocytes co-cultures increased lymphocytes apoptosis and we also have demonstrated that hMSCs are able to produce this interleukin PMID: 25184791
  39. The present data indicate that high plasma levels of IL-7 in the early post-transplant period are predictive for slow T cell reconstitution, increased risk of acute graft-versus-host disease and increased mortality following haematopoietic stem cell transplantation. PMID: 25263171
  40. IL-7 elevates miR-124 to decrease the expression of splicing regulator PTB and represses CD95 mRNA splicing. PMID: 25411246
  41. These results strongly suggest that IL-7/IL-7R prevents apoptosis by upregulating the expression of bcl-2 and by downregulating the expression of bax PMID: 24695377
  42. These data suggest that increased IFN-alpha activity may promote the loss of T cells by accelerating cell turnover and activation-induced cell death while decreasing the renewal of T cells by inhibiting the proliferative effect of IL-7. PMID: 25063872
  43. Diminished T-cell responsiveness to IL-7. PMID: 24585897
  44. Low-level transient antigenic stimuli during cART were not associated with changes in the thymic function or the IL-7/CD127 system. PMID: 24820104
  45. IL-7 can have a significant impact in sustaining expansion and persistence of adoptively chimeric antigen receptor-redirected cytotoxic T lymphocytes. PMID: 24097874
  46. IL-23 does not induce IL-7 expression in microglia and astrocytes. PMID: 24224652
  47. Changes of IL-7 expression in different phases of Graves ophthalmopathy (GO) suggested that IL-7 may play an important role in the pathogenesis of GO. PMID: 23188693
  48. These results suggest that ineffective responses to IL-7 could impair the transition to memory cells of naive CD4(+) T lymphocytes recognizing self-peptides in the setting of strong costimulation. PMID: 23454917
  49. our data point toward an unexpected new role for IL-7 as a potential autocrine mediator of lymphatic drainage PMID: 23963040
  50. our data show that IL-7 negatively regulates Tregs PMID: 23966629

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed