Recombinant Human Interleukin-4 Receptor Subunit Alpha (IL4R) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05347P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Interleukin-4 Receptor Subunit Alpha (IL4R) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05347P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Interleukin-4 Receptor Subunit Alpha (IL4R) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a extracellular protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells is less than 20 ng/ml. |
| Uniprotkb | P24394 |
| Target Symbol | IL4R |
| Synonyms | IL4R; IL4RA; 582J2.1; Interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD antigen CD124 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-hFc |
| Complete Sequence | MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQ |
| Expression Range | 26-231aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 50.2 kDa |
| Research Area | Immunology |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.; Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted. |
| Protein Families | Type I cytokine receptor family, Type 4 subfamily |
| Database References | HGNC: 6015 OMIM: 147781 KEGG: hsa:3566 STRING: 9606.ENSP00000170630 UniGene: PMID: 28706306 |
