Recombinant Human Interleukin-37 (IL37) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08715P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Interleukin-37 (IL37) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08715P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Interleukin-37 (IL37) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9NZH6 |
Target Symbol | IL37 |
Synonyms | FIL1; FIL1 zeta; FIL1(ZETA); FIL1Z; IL 1 zeta; IL 1F7; IL 1F7b (IL 1H4; IL 1H; IL 1RP1) ; IL 1H4; IL 1RP1; IL 1X; IL 1X protein; IL-1 zeta; IL-1F7; IL-1H; IL-1H4; IL-1RP1; IL-1X; IL-37; IL1F7 (canonical product IL 1F7b) ; IL1F7; IL1F7_HUMAN; IL1H4; IL1RP1; Interleukin 1 family member 7; interleukin 1 family; member 7 (zeta); Interleukin 1 homolog 4; Interleukin 1 related protein; Interleukin 1 superfamily z; Interleukin 1 zeta; Interleukin 37; Interleukin-1 family member 7; Interleukin-1 homolog 4; Interleukin-1 zeta; Interleukin-1-related protein; Interleukin-23 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD |
Expression Range | 1-218aa |
Protein Length | Full Length |
Mol. Weight | 51.1kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation. |
Subcellular Location | Cytoplasm, cytosol. Nucleus. Secreted. |
Protein Families | IL-1 family |
Database References | HGNC: 15563 OMIM: 605510 KEGG: hsa:27178 STRING: 9606.ENSP00000263326 UniGene: PMID: 30206230 |