Recombinant Human Interleukin-37 (IL37), Active

Name: Recombinant Human Interleukin-37 (IL37), Active
Brand: Beta LifeScience
SKU: BLC-05420P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, Buy cytokines, chemokines, and growth factors for research online, High-purity interleukins & receptors for research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Interleukin-37 (IL37), Active is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Human IL-18R beta in functional ELISA is less than 10 ug/ml.
Uniprotkb	Q9NZH6
Target Symbol	IL37
Synonyms	FIL1; FIL1 zeta; FIL1(ZETA); FIL1Z; IL 1 zeta; IL 1F7; IL 1F7b (IL 1H4; IL 1H; IL 1RP1) ; IL 1H4; IL 1RP1; IL 1X; IL 1X protein; IL-1 zeta; IL-1F7; IL-1H; IL-1H4; IL-1RP1; IL-1X; IL-37; IL1F7 (canonical product IL 1F7b) ; IL1F7; IL1F7_HUMAN; IL1H4; IL1RP1; Interleukin 1 family member 7; interleukin 1 family; member 7 (zeta); Interleukin 1 homolog 4; Interleukin 1 related protein; Interleukin 1 superfamily z; Interleukin 1 zeta; Interleukin 37; Interleukin-1 family member 7; Interleukin-1 homolog 4; Interleukin-1 zeta; Interleukin-1-related protein; Interleukin-23
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	Tag-Free
Complete Sequence	KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Expression Range	53-218aa
Protein Length	Partial
Mol. Weight	18.7 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 2 mM DTT, pH 7.4
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.

Target Details

Target Function	Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.
Subcellular Location	Cytoplasm, cytosol. Nucleus. Secreted.
Protein Families	IL-1 family
Database References	HGNC: 15563 OMIM: 605510 KEGG: hsa:27178 STRING: 9606.ENSP00000263326 UniGene: PMID: 30206230 IL-37 can be secreted extracellularly, and binds to IL-18Ra chain and recruits Toll/IL-1R (TIR)-8 for transducing anti-inflammatory signaling. IL-37 is upregulated in an inducible manner and negatively regulates signaling mediated by TLR agonists and pro-inflammatory cytokines. PMID: 28548248 Our results showed that IL-37 plays an inhibitory role in non-small cell lung cancer progression, possibly by suppressing STAT3 activation and decreasing epithelial-to-mesenchymal transition by inhibiting IL-6 expression. IL-37 could serve as a potential novel tumor suppressor in non-small cell lung cancer PMID: 29575809 TIM-3 and IL-37 may be used as potential biomarkers of active rheumatoid arthritis. PMID: 30106887 This study suggests that human IL-37 overexpressed in mice reduces lean body mass by reducing food intake. PMID: 30072596 These data suggest that IL37 is a new susceptibility gene for Coronary artery disease (CAD), which provides a potential target for the prevention and treatment of CAD PMID: 28181534 In allergic rhinits patients, the IL-1R8 ligand IL-37 could potentially modulate aberrant immune responses by attenuating IL-17 and IL-4 production by CD4+ T cells. PMID: 29730558 Review of role of interleukin 37 in physiology and disease. PMID: 29805973 this study shows that Interleukin-37 alleviates airway inflammation and remodeling in asthma via inhibiting the activation of NF-kappaB and STAT3 signalings PMID: 29268192 IL1F7 gene polymorphism does not significantly influence rheumatoid arthritis susceptibility in the Northern Chinese Han population. PMID: 29336365 IL37 may be an important cytokine in the pathogenesis of allergic rhinitis. PMID: 29115624 results suggest that there was a low level of interleukin 37 in the eutopic and ectopic endometria of patients with adenomyosis PMID: 28762845 Study concludes that recombinant human interleukin-37 enhances the suppressive activity of CD4(+)CD25(+) regulatory T cells and might be a potential immunomodulator for the treatment of septic complications. PMID: 27941849 IL-37 level is elevated in systemic lupus erythematous patients in comparison to healthy controls and is correlated to high disease activity, mucocutaneous and renal involvement. PMID: 28627005 An association of IL-37 single nucleotide polymorphism rs3811047 with Behcet's disease, but not Vogt-Koyanagi-Harada disease in Han Chinese. PMID: 27775096 The data suggest that IL-10, but not IL-37, may have potential as a biomarker predictive for disease activity in Systemic lupus erythematosus. PMID: 27708376 this study shows that IL-37 causes excessive inflammation and tissue damage in murine pneumococcal pneumonia PMID: 28601872 common genetic variants of IL37 lead to different immune-inhibitory potencies. PMID: 27665946 IL-37 increased from normal control (NC) to oral leukoplakia (OLK) and oral squamous cell carcinoma (OSCC). IL-37 expression was lower in OSCC with lymph node metastasis than those without metastasis. IL-37 overexpression in RAW264.7 cells remarkably reduced the pseudopodia, vacuolization and the expression of IL-6, TNF-alpha, and IL-1beta. IL-37 and IL-18Ralpha but not IL-18BP have similar expression and location in ... PMID: 27225603 We conclude that under low-grade inflammatory conditions, hematopoietic IL-37 expression reduces the inflammatory state, but does not influence atherosclerosis development in hyperlipidemic LDLr-deficient mice. PMID: 28792474 The IL- 37 (rs3811047) polymorphism contributes to the development of ADs in a Chinese population. PMID: 29642198 IL-37 is produced primarily by CD4+ T cells and vascular smooth muscle cells and that it plays a protective role in atherosclerotic injury by directing a switch in CD4+ T lymphocyte phenotypes in addition to directly regulating the expression of caspase-3 to reduce H2O2- and pro-inflammatoryinduced SMC apoptosis. PMID: 29439249 Blocking IL-1 with IL-37 alleviates the symptoms in patients with inflammatory diseases including arteriosclerosis. The impact of IL-37 on inflammatory cytokines mediating atherosclerosis is beneficial and protective. PMID: 28420489 these data highlight the importance of IL-37 in the cell proliferation and progression of hepatocellular carcinoma PMID: 27835881 Serum Il-37 level is significantly increased in acute coronary syndrome. IL-37 may exert a cardioprotective effect by suppressing ROCK activity. PMID: 28039466 this study found that IL-37 levels in peritoneal fluid and in serum were significantly higher in patients with endometriosis compared to women without endometriosis PMID: 28322860 IL-37 profile in patients with acute coronary syndrome and the increased IL-37 concentration was associated with a worse clinical in-hospital outcome in STEMI patients undergoing PPCI PMID: 28237549 this study shows that human IL-37 inhibited LPS-induced mouse osteoclast formation and bone resorption via inhibition of LPS-induced osteoclast related cytokines PMID: 27154248 serum IL-37 and its mRNA expression is increased in Ankylosing spondylitis (AS) patients with special consideration in patient with Osteoporosis and correlates with disease activity and BMD which indicate that IL-37 may provide a novel research target for pathogenesis and therapy of AS. PMID: 28502149 this study shows that macrophage-specific expression of IL-37 in hyperlipidemic mice attenuates atherosclerosis PMID: 29030487 IL-27 and IL-37 limit the induction of particular T cell subsets along with cytokine responses in S. stercoralis infections, which suggest the importance of IL-27 and IL-37 in immune modulation in a chronic helminth infection. PMID: 28874444 constitutive IL-37 secretion by myeloid dendritic cells may serve to maintain an anti-inflammatory milieu at steady state, whereas IL-37 is stored in monocytes to be available for rapid release upon inflammatory encounters. PMID: 27881605 IL-37 regulates autophagy in SMMC-7721 and Huh-7 cells via inhibition of the PI3K/AKT/mTOR signaling pathway. PMID: 28433890 IL-37 inhibited the proliferation of hepatocellular carcinoma SMMC-7721 cells. PMID: 28395710 these findings reveal that intracellular IL-37b is a critical factor in the negative regulation of multiple signaling pathways that modulate the expression of metastasis-related genes PMID: 28092676 IL-37 may be employed as a new molecular target for the therapy and diagnosis of Tuberculosis. PMID: 28076390 IL37 itself reduced IL1beta, IL6 and IL8 production in osteoarthritis chondrocytes, indicating that IL37 is able to induce a counter-regulatory anti-inflammatory feedback loop in chondrocytes. In addition, IL37 dampens catabolic enzyme expression. PMID: 27940589 IL-37 is elevated in AF patients and its expression is closely associated with AF subgroups. Thus, IL-37 may provide a novel research target for the pathogenesis and therapy of AF. PMID: 28244597 These results indicate that a decreased IL-37 expression by colon epithelial cells may be an important factor for increasing the recruitment of immune cells and subsequently developing microscopic colitis. PMID: 28044228 reviewed the updated evidence indicating the roles of IL-35 and IL-37 in asthma PMID: 27878686 serum level of IL-37 plays a part in the pathophysiology of multiple myeloma progression. PMID: 27807338 this study shows that IL-37 could decrease both NF-kappaB and ICAM-1 expression upon TLR2 activation in human coronary artery endothelial cells, and that this effect may be due to its inhibition on NF-kappaB PMID: 27233003 Results show that elevated plasma IL-37 level and its associations with anti-Sm, anti-RNP and C3 in systemic lupus erythematosus patients suggest that IL-37 may be implicated in this disease. PMID: 27125292 the present data suggest that rs2723176 SNP of IL-37 is involved in the development of TB infection. PMID: 27761939 this study reviews the role of IL-37 as a key suppressor of asthma mediated by mast cells PMID: 27982737 In the discovery phase, two nonsynonymous SNPs (rs3811046 and rs3811047), located in the IL1F7 gene and in an intergenic region, respectively were found to be weakly associated with non-high tension glaucoma cases. PMID: 27533638 CCL22 and IL-37 with a co-localization in the A549 cells inhibited the proliferation PMID: 27499437 increased IL-37 concentrations are associated with the onset of arterial calcification PMID: 27451144 These findings suggest that increased expression of IL-37 was present in eutopic and ectopic endometrium of women with ovarian endometriosis, which might be involved in the inflammatory process of endometriomas. PMID: 26342048 These fi ndings suggest that elevation of HLA-G and IL-37 in hepatitis C virus may play an important role in response to combined therapy with interferon-apha and ribovirin. PMID: 27112970

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Interleukin-37 (IL37), Active

Recombinant Human Interleukin-37 (IL37), Active

Product Overview

Target Details

FAQs