Recombinant Human Interleukin-37 (IL37), Active
Beta LifeScience
SKU/CAT #: BLC-05420P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Interleukin-37 (IL37), Active
Beta LifeScience
SKU/CAT #: BLC-05420P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Interleukin-37 (IL37), Active is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by its ability to bind Human IL-18R beta in functional ELISA is less than 10 ug/ml. |
| Uniprotkb | Q9NZH6 |
| Target Symbol | IL37 |
| Synonyms | FIL1; FIL1 zeta; FIL1(ZETA); FIL1Z; IL 1 zeta; IL 1F7; IL 1F7b (IL 1H4; IL 1H; IL 1RP1) ; IL 1H4; IL 1RP1; IL 1X; IL 1X protein; IL-1 zeta; IL-1F7; IL-1H; IL-1H4; IL-1RP1; IL-1X; IL-37; IL1F7 (canonical product IL 1F7b) ; IL1F7; IL1F7_HUMAN; IL1H4; IL1RP1; Interleukin 1 family member 7; interleukin 1 family; member 7 (zeta); Interleukin 1 homolog 4; Interleukin 1 related protein; Interleukin 1 superfamily z; Interleukin 1 zeta; Interleukin 37; Interleukin-1 family member 7; Interleukin-1 homolog 4; Interleukin-1 zeta; Interleukin-1-related protein; Interleukin-23 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Complete Sequence | KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD |
| Expression Range | 53-218aa |
| Protein Length | Partial |
| Mol. Weight | 18.7 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 2 mM DTT, pH 7.4 |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
| Target Function | Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation. |
| Subcellular Location | Cytoplasm, cytosol. Nucleus. Secreted. |
| Protein Families | IL-1 family |
| Database References | HGNC: 15563 OMIM: 605510 KEGG: hsa:27178 STRING: 9606.ENSP00000263326 UniGene: PMID: 30206230 |
