Recombinant Human Interleukin-36 Receptor Antagonist Protein (IL36RN) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04269P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Interleukin-36 Receptor Antagonist Protein (IL36RN) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04269P
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Chemokines and receptors – essential regulators of immune response, High-purity interleukins & receptors for research, High-quality cytokines for advanced research, High-quality recombinant proteins, Recombinant proteins fall special offers - full-length proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Interleukin-36 Receptor Antagonist Protein (IL36RN) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9UBH0 |
| Target Symbol | IL36RN |
| Synonyms | AI413231; Family of interleukin 1 delta; FIL1; FIL1 delta; FIL1(DELTA); FIL1D; Fil1delta; I36RA_HUMAN; IL 1 delta; IL 1 related protein 3; IL 1F5 (IL 1HY1, FIL1 delta, IL 1RP3, IL 1L1, IL 1 delta); Il 1h3; IL 1HY1; IL 1L1; IL 1ra homolog; IL 1ra homolog, IL1F5 (Canonical product IL 1F5a); IL 1RP3; IL-1 delta; IL-1-related protein 3; IL-1F5; IL-1HY1; IL-1L1; IL-1ra homolog 1; IL-1RP3; IL1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; IL36RN; Interleukin 1 delta; Interleukin 1 family member 5 (delta); Interleukin 1 family member 5; Interleukin 1 HY1; Interleukin 1 like protein 1; Interleukin 1 receptor antagonist homolog 1; Interleukin 36 receptor antagonist; Interleukin-1 delta; Interleukin-1 family member 5; Interleukin-1 HY1; Interleukin-1 receptor antagonist homolog 1; Interleukin-1-like protein 1; Interleukin-36 receptor antagonist protein; MGC29840; PSORP; RP23-176J12.6 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
| Expression Range | 1-155aa |
| Protein Length | Full Length |
| Mol. Weight | 33.0kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR. |
| Subcellular Location | Cytoplasm. Secreted. |
| Protein Families | IL-1 family |
| Database References | HGNC: 15561 OMIM: 605507 KEGG: hsa:26525 STRING: 9606.ENSP00000259212 UniGene: PMID: 29571080 |
