Recombinant Human Interleukin-36 Receptor Antagonist Protein (IL36RN) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04269P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Interleukin-36 Receptor Antagonist Protein (IL36RN) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04269P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Interleukin-36 Receptor Antagonist Protein (IL36RN) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q9UBH0
Target Symbol IL36RN
Synonyms AI413231; Family of interleukin 1 delta; FIL1; FIL1 delta; FIL1(DELTA); FIL1D; Fil1delta; I36RA_HUMAN; IL 1 delta; IL 1 related protein 3; IL 1F5 (IL 1HY1, FIL1 delta, IL 1RP3, IL 1L1, IL 1 delta); Il 1h3; IL 1HY1; IL 1L1; IL 1ra homolog; IL 1ra homolog, IL1F5 (Canonical product IL 1F5a); IL 1RP3; IL-1 delta; IL-1-related protein 3; IL-1F5; IL-1HY1; IL-1L1; IL-1ra homolog 1; IL-1RP3; IL1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; IL36RN; Interleukin 1 delta; Interleukin 1 family member 5 (delta); Interleukin 1 family member 5; Interleukin 1 HY1; Interleukin 1 like protein 1; Interleukin 1 receptor antagonist homolog 1; Interleukin 36 receptor antagonist; Interleukin-1 delta; Interleukin-1 family member 5; Interleukin-1 HY1; Interleukin-1 receptor antagonist homolog 1; Interleukin-1-like protein 1; Interleukin-36 receptor antagonist protein; MGC29840; PSORP; RP23-176J12.6
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Expression Range 1-155aa
Protein Length Full Length
Mol. Weight 33.0kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.
Subcellular Location Cytoplasm. Secreted.
Protein Families IL-1 family
Database References

HGNC: 15561

OMIM: 605507

KEGG: hsa:26525

STRING: 9606.ENSP00000259212

UniGene: PMID: 29571080

  • IL36RN may be the major disease-causing gene in generalized pustular psoriasis patients in Han population in Sichuan region of China. PMID: 30075588
  • IL36RN mutations were strongly linked with early onset and hyponychial pustules, but not with therapeutic efficacy of acitretin or recurrence frequency. Early onset and hyponychial pustules may be specific to IL36RN mutation, however this alone is an insufficient biomarker for acitretin therapy. PMID: 29619998
  • Using different blood leukocyte and skin resident cell preparations, and recombinant proteins, the authors have identified that neutrophil elastase, but not other neutrophil derived proteases, cleaves IL-36Ra into its highly active antagonistic form. PMID: 27101808
  • A study on the association of IL36RN mutations that affect protein expression and function with phenotype in patients with generalized pustular psoriasis. PMID: 27220475
  • The findings indicate that IL36RN mutations do not seem to contribute to the pathogenesis of common, nonpustular forms of psoriasis, but to the rarer pustular manifestations such as GPP, acrodermatitis continua suppurativa of Hallopeau and acute generalized exanthematous pustulosis. PMID: 27038307
  • Some cases of geographic tongue are caused by IL36RN mutations, while those lacking mutations are associated with an imbalance in expression between IL-36Ra and IL-36gamma proteins in tongue tissue. PMID: 27900482
  • Study data and the previous European study suggest that palmoplantar pustulosis is not associated with mutations of the IL36RN gene. PMID: 27542682
  • Case Report: short-term infliximab for treatment of juvenile generalized pustular psoriasis with IL36RN mutation. PMID: 26627198
  • The authors present a case of strikingly distinct phenotypes seen in two IL36RN mutation carriers from the same nonconsanguineous pedigree. This mutation it appears may influence the age of onset. PMID: 26147717
  • The present study identified IL-36RN in various species and investigated the associations between IL-36RN and cancer prognosis. PMID: 26676204
  • We identified a novel homozygous missense mutation in IL36RN in two siblings, and showed the molecular basis of the condition to be both distinct from psoriasis and distinct between the two families studied. PMID: 25688670
  • generalized pustular psoriasis and early onset, ever generalized pustular psoriasis (more than two attacks), ever acrodermatitis continua of Hallopeau, inverse psoriasis, and a family history of pustular psoriasis were associated with IL36RN mutation. PMID: 26589685
  • IL36RN was identified as strong regulators of skin pathology in both lesional and non-lesional skin samples. PMID: 25897967
  • IL36RN missense mutation was not associated with psoriasis. PMID: 25989471
  • we report T123M and 115+6T>C mutations, both homozygous in nature, in two Japanese individuals with Zumbusch type of generalized pustular psoriasis. PMID: 25615897
  • found 2 new variants and 4 known IL36RN variants in 29 generalized pustular psoriasis patients PMID: 25212972
  • identified a novel IL36RN missense mutation, c.334G > A in exon 5, that caused p.E112K substitution and was located adjacent to a 113 amino acid residue in generalized pustular psoriasis PMID: 25468355
  • The study found that IL36RN alleles define a generalized pustular psoriasis phenotype characterized by early onset, high risk of systemic inflammation, and low prevalence of psoriasis vulgaris. PMID: 25458002
  • in a Chinese Daur family with generalized pustular psoriasis, identified a homozygous splice site mutation c.115+6T>C in intron 3 in both patients; other 4 family members and 7 healthy controls carried heterozygous c.115+6T>C mutations PMID: 24979538
  • Individuals with IL36RN mutations are very susceptible to Generalized pustular psoriasis (GPP) or GPP-related generalized pustulosis induced by drugs. [review] PMID: 24656634
  • We report two cases of impetigo herpetiformis with homozygous and heterozygous IL36RN mutations. PMID: 24717243
  • IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin PMID: 24829417
  • IL36RN variants are unlikely to confer significant disease risk for psoriasis vulgaris. PMID: 23792462
  • Acrodermatitis is a clinical phenotype of DITRA: evidence a variant of pustular psoriasis... recessively inherited mutations in the IL36RN gene, which encodes interleukin-36 receptor antagonist... the cause of familial GPP, a condition termed DITRA PMID: 23428889
  • The majority of generalized pustular psoriasis alone is caused by deficiency of the interleukin-36 receptor antagonist due to IL36RN mutations. PMID: 23698098
  • The percentage of IL36RN mutations of pediatric generalized pustular psoriasis patients was much higher than that of adult onset patients. PMID: 23863864
  • Our rate of 38.9% IL36RN mutations provides further evidence that generalized pustular psoriasis is heterogenous. PMID: 23648549
  • IL36RN missense mutations may underlie some forms of acute generalized exanthematous pustulosis. PMID: 23358093
  • Results indicate that IL36RN mutations are not associated with pustular psoriasis in Chinese populations. PMID: 22862555
  • Rare pathogenic variants in IL36RN underlie a spectrum of psoriasis-associated pustular phenotypes. PMID: 23303454
  • Data indicate that IL36RN mutations were identified in 2 of 14 Japanese generalized pustular psoriasis (GPP) patients. PMID: 22903787
  • The mutation in the interleukin-36-receptor antagonist gene plays a role in generalised pustular psoriasis PMID: 22325761
  • These data provide evidence that IL-38 binds to the IL-36R, as does IL-36Ra. PMID: 22315422
  • Interleukin-36 (IL-36) ligands require processing for full agonist (IL-36alpha, IL-36beta, and IL-36gamma) or antagonist (IL-36Ra) activity PMID: 21965679
  • Mutations in IL36RN/IL1F5 are associated with the severe episodic inflammatory skin disease known as generalized pustular psoriasis. PMID: 21839423
  • Expression of IL-1F5 is increased in human plaque psoriasis skin and is overexpressed in the lesional psoriatic skin of transgenic mice. PMID: 21242515
  • results suggest that polymorphisms within IL1RN and IL1L1 themselves or a gene in linkage disequilibrium with IL1RN and IL1L1 predispose to the more severe forms of alopecia areata PMID: 11841485
  • The commnon variants in the IL-1 cluster gene are not associated with incidence of restenosis in patients after PTCA. PMID: 14644395
  • IL-1beta-511T was associated with reflux esophagitis having hyperacidity. PMID: 16211343
  • Data show that the gene expression for interleukin-8, IL-10, and IL-1Ra, but not IL-6, is increased in blood leukocytes taken from athletes following 2 hours of intensive cycling and is not influenced by carbohydrate compared with placebo ingestion. PMID: 16978071
  • IL-1 delta, which shows striking homology to IL-1 receptor antagonist, specifically and potently inhibits NF-kappa B activation through the orphan IL-1 receptor-related protein 2. PMID: 11466363

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Sale
    SDS-PAGE analysis of Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein, CAT# BLT-08014P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein
    • Molecule: CEBPB;
    • Species: Mouse;
    • Expression system: E.coli;
    • Tag: N-His-GST;
    • Sequence: 1-296aa;
    CAT#: BLT-08014P

    Save $50
    Sale
    SDS-PAGE analysis of Human BAX (Apoptosis Regulator Bax) - Recombinant Protein, CAT# BLT-07419P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human BAX (Apoptosis Regulator Bax) - Recombinant Protein
    • Molecule: BAX;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-171aa;
    CAT#: BLT-07419P

    Save $50
    Recently viewed