Recombinant Human Interleukin-36 Alpha (IL36A) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03701P

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL36A.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL36A.
Recombinant Human Interleukin-36 Alpha (IL36A) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03701P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Interleukin-36 Alpha (IL36A) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9UHA7 |
Target Symbol | IL36A |
Synonyms | FIL1; FIL1 epsilon; FIL1(EPSILON); FIL1E; IL 1 epsilon; IL 1F6; IL 1H1; IL-1 epsilon; IL-1F6; IL1E; IL1F6; IL1F6_HUMAN; IL1RP2; IL36 alpha; IL36A; Interleukin 1 epsilon; Interleukin 1 family member 6 (epsilon); Interleukin 1 family member 6; Interleukin 36 alpha; Interleukin-1 epsilon; Interleukin-1 family member 6; MGC129552; MGC129553; MGC151479; MGC151481; OTTMUSP00000012798; RP23-176J12.4 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF |
Expression Range | 1-158aa |
Protein Length | Full Length |
Mol. Weight | 44.7kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of proinflammatory cytokines such as TNF-alpha, IL-8 and IL-6. In cultured monocytes upregulates expression of IL-1A, IL-1B and IL-6. In myeloid dendritic cells involved in cell maturation by upregulating surface expression of CD83, CD86 and HLA-DR. In monocyte-derived dendritic cells facilitates dendritic cell maturation and drives T-cell proliferation. May play a role in proinflammatory effects in the lung. |
Subcellular Location | Cytoplasm. Secreted. |
Protein Families | IL-1 family |
Database References | |
Tissue Specificity | Expressed in immune system and fetal brain, but not in other tissues tested or in multiple hematopoietic cell lines. Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Increased in lesional psoriasis sk |
Gene Functions References
- serum IL-36alpha levels were higher in active systemic lupus erythematosus patients and correlated with disease activity and arthritis PMID: 29571080
- Data suggest that interleukin-36alpha (IL-36alpha) plays an important role in the pathophysiology of inflammation and fibrosis in the pancreas via an autocrine function. PMID: 28099250
- The data identify a novel role for IL-36 signaling in colonic inflammation and indicate that the IL-36R pathway may represent a novel target for therapeutic intervention. PMID: 26813344
- IL-36a was displayed to be able to suppress the growth of epithelial ovarian cancer cells in our setting, which is suggestive of its druggable potential in curing the epithelial ovarian cancer and that upregulation of IL-36a was found to be capable of inhibiting the growth of epithelial ovarian cancer cells. PMID: 28621240
- Increased Expression of Interleukin-36 is associated with Inflammatory Bowel Disease. PMID: 26752465
- IL-36alpha acts as a pro-inflammatory cytokine at cartilage level, by increasing the expression of markers of inflammation and cartilage catabolism. PMID: 26560022
- Study shows that plasma concentrations of IL-36alpha and IL-36gamma are overexpressed in active systemic lupus erythematosus patients and that IL-36alpha has a substantial pro-inflammatory effect through regulation of IL-6 and CXCL8 production. PMID: 26516833
- increases maturation of monocyte-derived dendritic cells PMID: 25700962
- IL36A-IL36R axis is modulated in patients with primary Sjogren's syndrome. PMID: 25902739
- IL-36alpha was highly expressed in nearly half of all colorectal cancer patients. Low expression level of IL-36alpha correlated with larger tumor size and advanced cancer stage. Low expression of IL-36alpha resulted in a poor prognosis of colorectal cancer patients. PMID: 25550854
- Results show that IL-36alpha expression may play a pivotal role in determining the prognosis of hepatocellular carcinoma (HCC). PMID: 24061617
- The novel cytokine interleukin-36alpha is expressed in psoriatic and rheumatoid arthritis synovium. PMID: 23268368
- Expression of IL-1F6 is increased in human plaque psoriasis skin and in the lesional skin of transgenic mice compared with monotransgenic littermates. PMID: 21242515
- A functional IL-6 polymorphism has been weakly associated with level of peak bone mineral density and the rate of forearm trabecular postmenopausal bone loss in a cohort of women. PMID: 12110411
- Dysregulated expression in transgenic mice can promote cutaneous inflammation, revealing potential novel targets for the treatment of inflammatory skin disorders. PMID: 17908936
- IL-1 epsilon, an interleukin-1 agonist, activates NF-kappa B through the orphan IL-1 receptor-related protein 2 and may constitute part of an independent signaling system present in human epithelial barriers. PMID: 11466363