Recombinant Human Interleukin-3 (IL3) Protein (His), Active

Name: Recombinant Human Interleukin-3 (IL3) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05427P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, Buy cytokines, chemokines, and growth factors for research online, High-purity interleukins & receptors for research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Interleukin-3 (IL3) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 2 ng/ml.
Uniprotkb	P08700
Target Symbol	IL3
Synonyms	Colony stimulating factor multiple; Hematopoietic growth factor; IL 3; IL-3; IL3; IL3_HUMAN; Interleukin 3 (colony stimulating factor; multiple); Interleukin 3; Interleukin-3; Mast cell growth factor; MCGF; MGC79398; MGC79399; Multi CSF; Multilineage colony stimulating factor; Multipotential colony stimulating factor; Multipotential colony-stimulating factor; OTTHUMP00000065963; P cell stimulating factor ; P-cell-stimulating factor
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His
Complete Sequence	APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Expression Range	20-152aa
Protein Length	Full Length of Mature Protein
Mol. Weight	16.1 kDa
Research Area	Immunology
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
Subcellular Location	Secreted.
Protein Families	IL-3 family
Database References	HGNC: 6011 OMIM: 147740 KEGG: hsa:3562 STRING: 9606.ENSP00000296870 UniGene: PMID: 29554544 The present study demonstrates for the first time that IL-3 has an important role in enhancing the migration of human MSCs through regulation of the CXCR4/SDF-1alpha axis. These findings suggest a potential role of IL-3 in improving the efficacy of MSCs in regenerative cell therapy. PMID: 28705238 These results indicate that IL-3 regulates endothelial cells-extracellular vesicles release, cargo and IL-3 angiogenic paracrine action via STAT5. PMID: 27157262 T-GM-CSF and -IL-3 significantly, and reciprocally, blunted receptor binding and myeloid progenitor cell proliferation activity of both FL-GM-CSF and -IL-3 in vitro and in vivo PMID: 28344320 Results show that IL-3 induces several signaling pathways associated with increased cell survival under oxidative stress. This activity correlates with previous fi ndings indicating glucose uptake stimulation by IL-3, which together contribute to an emerging picture of a broader mechanism promoting cell survival. PMID: 27862234 The IL-3/ GM-CSF effected on the myofibroblastic differentiation of human adipose derive stromal cells (hASCs) as well as it did on human dermal fibroblasts (HDFs). PMID: 28377320 Genetically engineered mesenchymal stromal cells produce IL-3 and TPO to further improve human scaffold-based xenograft models PMID: 28456746 IL-3 hardly down-regulates the alpha-chain of its receptor without depleting the common beta-chain, which enables extraordinarily sustained signaling events, predominantly the activation of Stat5. PMID: 27443880 genetic polymorphisms in the immune genes IL-3 rs181781 and CTLA4 rs4553808 may influence the TAC dose-adjusted concentrations PMID: 28112181 Our results indicated that the IL-3 and IL-13 polymorphisms were not associated with rheumatoid arthritis (RA). stratification analyses suggested that the IL-13 rs1800925 CT and CT/CC genotypes increased the risk of RA in patients with erythrocyte sedimentation rate (ESR) <25.00. these findings suggest that the IL-13 rs1800925 C/T polymorphism may be associated with increased risk of RA in ESR PMID: 27323078 results suggest that IL-3 and IL-12p40 could be considered as molecular predictors for recurrent wheezing due to RSV infection PMID: 26299549 results suggest that IL3 is an important genetic regulator for human brain volume variation and implied that IL3 might have experienced weak or modest positive selection in the evolutionary history of humans PMID: 26875095 Thymic stromal lymphopoietin activation of basophils in patients with allergic asthma is IL-3 dependent PMID: 25962901 were not able to confirm the association of IL-3 SNPs with schizophrenia. PMID: 26277822 findings showed that high plasma IL-3 levels are associated with high mortality in sepsis PMID: 25766237 Genetic variation in interleukin-3 gene is associated with breast cancer risk. PMID: 24670917 results suggest that HuR recognizes the ARE-rich region in the IL-3 3'-UTR and plays a role in the IL-3 3'-UTR-mediated post-transcriptional control in T-cells PMID: 24658545 A single nucleotide polymorphism (SNP; rs20541) in the IL-13 gene has been recognized as a risk factor for asthma. PMID: 23978640 This study is the first to link beta-catenin activation to IL-3 and suggests that targeting IL-3 signaling may be an effective approach for the inhibition of beta-catenin activity in some patients with AML. PMID: 24598054 IL3 SNP rs40401 is significantly associated with the risk of asthma in young adult Japanese women. PMID: 24684517 This is the first study to show a significant positive association between IL3 SNP rs40401 variant and the risk of rhinoconjunctivitis. PMID: 23953855 IL3 rs2073506 G>A polymorphism is associated with an increased risk for esophageal cancer of nodal and metastatic stages. PMID: 23726808 Genetic variation in the IL3 promoter affects human brain volume by regulating proliferation and survival of neural progenitors. PMID: 23226269 Transgenic mice are used to study the developmental regulation of the closely linked IL-3 and granulocyte-macrophage colony stimulting factor (GM-CSF) locus and to identify DNA enhancer elements required for its correct activity in vivo. PMID: 23024272 data indicate that within microenvironments rich in betac-family cytokines and TNF, eosinophils are a source of proMMP-9 and highlight a previously unrecognized role for synergistic interaction between TNF and betac-family cytokinea, for proMMP-9 synthesis PMID: 22321809 This study demonistrated that Carriers of the minor allele for a single nucleotide polymorphism in IL13 (rs1295686) were more likely to report breast pain prior to surgery (P = .019). PMID: 22515947 an IL-3 autocrine loop can drive a tumor endothelial switch and that targeting IL-3 might confer a significant therapeutic advantage to hamper tumor angiogenesis PMID: 21643009 IL-3 provides cellular protection against amyloid-beta neurotoxicity in primary cortical neuronal cells and may play a neuroprotective role in Alzheimer's disease. PMID: 20964623 The IL3 genotypes rs40401 and rs40401 were found to exert a protective effect against malaria attacks. PMID: 21224257 Data indicate a role for PLCgamma2 and Ca(2+) signaling through the modulation of MEK/ERK in IL3/GM-csf stimulated human hematopoietic stem/progenitor cells. PMID: 21506110 The interaction of 6-locus from the 5 interleukin genes might confer higher risk for graves'disease and Graves'ophthalmopathy than single risk allele. PMID: 20332709 IL-3 genotypes of 60 acute rejection (AR) subjects and the 270 patients without AR demonstrated a significant relationship between genotype frequencies and the SNPs PMID: 21168724 Human IL-3/GM-CSF knock-in mice support human alveolar macrophage development and human immune responses in the lung. PMID: 21262803 propose that RhoH functions as a negative regulator for IL3-induced signals through modulation of the JAK-STAT pathway PMID: 20738848 the domain 1 D-E loop disulfide of hbetac and beta(IL-3) in maintaining the precise positions of ligand-binding residues necessary for normal high affinity binding and signaling PMID: 20516062 Two different modes of beta c binding are utilized in the presence of the hIL-3R alpha isoforms. PMID: 20472554 a novel role for VPA in enhancing the potential of IL-3 to stimulate megakaryopoiesis as well as erythropoiesis PMID: 20381581 The IL-3/GM-CSF locus undergoes progressive stages of activation, with stepwise increases in active modifications and the proportion of cytokine-expressing cells, throughout the course of T cell differentiation. PMID: 20147630 IL-3 and oncogenic Abl regulate the myeloblast transcriptome by altering mRNA stability PMID: 19829692 binding kinetics of native IL-3 and several variants to IL-3 receptor PMID: 11700046 IL-3 induces MHC class II and B7.2 expression on eosinophils and renders them capable of supporting T cell proliferation to superantigen and antigen-derived peptides. PMID: 11714768 inhibition of signaling by antisense oligodeoxynucleotides targeting the common beta chain of receptors PMID: 11763346 ectopically expressed in myeloid leukemic cells with t(5;12)(q31;p13), suggesting that expression of IL3 was deregulated by the translocation, indicating a variant leukemogenic mechanism for translocations involving the 5' end of ETV6 PMID: 11861295 Antiapoptotic cytokine IL-3 + SCF + FLT3L influence on proliferation of gamma-irradiated AC133+/CD34+ progenitor cells. PMID: 12002675 Monocytes cultured in the presence of IL-3 (plus IL-4) differentiate into dendritic cells that produce less IL-12 and shift T helper (Th) cell responses toward a Th2 cytokine pattern. PMID: 12055233 Data suggest that increased activity of mutated interleukin 3 is due to a change from a rare ligand to a common one, allowing the increase in IL-3-dependent signaling. PMID: 12093816 role in potentiating hematopoietic cell migration PMID: 12135758 The IL-3 gene is regulated by two enhancers that have distinct but overlapping tissue specificities. PMID: 12165512 WEHI-3B-derived IL-3 stimulation of mcl-1 gene transcription through the SIE motif involves phosphorylation of PU.1 at serine 142 by a p38(MAPK)-dependent pathway. PMID: 12612065 Incubation of eosinophils with IL-3 leads to reduced expression of IL-5R alpha which is sustained for up to 5 days; in contrast, expression of IL-3R alpha is increased by IL-3, whereas GM-CSF receptor alpha expression in eosinophils is unaffected by IL-3. PMID: 12759409

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Interleukin-3 (IL3) Protein (His), Active

Recombinant Human Interleukin-3 (IL3) Protein (His), Active

Product Overview

Target Details

FAQs