Recombinant Human Interleukin-22 Receptor Subunit Alpha-1 (IL22RA1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10103P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Interleukin-22 Receptor Subunit Alpha-1 (IL22RA1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10103P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Interleukin-22 Receptor Subunit Alpha-1 (IL22RA1) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q8N6P7 |
| Target Symbol | IL22RA1 |
| Synonyms | CRF2 9; CRF2-9; Cytokine receptor class-II member 9; cytokine receptor classII member 9; Cytokine receptor family 2 member 9; I22R1_HUMAN; IL-22 receptor subunit alpha-1; IL-22R-alpha-1; IL-22RA1; IL22 Receptor Alpha; IL22R; IL22R1; Il22ra1; ILTIF R1 chain; Interleukin 22 Receptor alpha 1; Interleukin 22 Receptor; Interleukin-22 receptor subunit alpha-1; ZcytoR11 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | SYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE |
| Expression Range | 250-573aa |
| Protein Length | Partial |
| Mol. Weight | 50.8kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Component of the receptor for IL20, IL22 and IL24. Component of IL22 receptor formed by IL22RA1 and IL10RB enabling IL22 signaling via JAK/STAT pathways. IL22 also induces activation of MAPK1/MAPK3 and Akt kinases pathways. Component of one of the receptor for IL20 and IL24 formed by IL22RA1 and IL20RB also signaling through STATs activation. Mediates IL24 antiangiogenic activity as well as IL24 inhibitory effect on endothelial cell tube formation and differentiation. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Protein Families | Type II cytokine receptor family |
| Database References | HGNC: 13700 OMIM: 605457 KEGG: hsa:58985 STRING: 9606.ENSP00000270800 UniGene: PMID: 28558005 |
