Recombinant Human Interleukin-20 Receptor Subunit Alpha (IL20RA) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05333P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Interleukin-20 Receptor Subunit Alpha (IL20RA) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05333P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Interleukin-20 Receptor Subunit Alpha (IL20RA) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by its ability to bind Human IL-20 in functional ELISA is less than 10 ug/ml. |
| Uniprotkb | Q9UHF4 |
| Target Symbol | IL20RA |
| Synonyms | class II cytokine receptor ZCYTOR7; CRF2 8; CRF2-8; Cytokine receptor class II member 8; Cytokine receptor class-II member 8; Cytokine receptor family 2 member 8; I20RA_HUMAN; IL 20R alpha; IL 20R1; IL-20 receptor subunit alpha; IL-20R-alpha; IL-20R1; IL-20RA; IL20 Receptor alpha; IL20RA; Interleukin 20 receptor alpha chain; Interleukin 20 receptor, alpha; interleukin-20 receptor I; Interleukin-20 receptor subunit alpha; ZcytoR7 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-6His |
| Complete Sequence | VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK |
| Expression Range | 30-250aa |
| Protein Length | Partial |
| Mol. Weight | 26.3 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
| Target Function | The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Protein Families | Type II cytokine receptor family |
| Database References | HGNC: 6003 OMIM: 605620 KEGG: hsa:53832 STRING: 9606.ENSP00000314976 UniGene: PMID: 27799070 |
