Recombinant Human Interleukin-17A (IL17A) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05734P
Recombinant Human Interleukin-17A (IL17A) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05734P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Interleukin-17A (IL17A) Protein (His), Active is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized Human IL17A at 2 μg/mL can bind Anti-IL17A recombinant antibody , the EC50 is 1.818-2.170 ng/mL. |
Uniprotkb | Q16552 |
Target Symbol | IL17A |
Synonyms | (IL-17)(IL-17A)(Cytotoxic T-lymphocyte-associated antigen 8)(CTLA-8) |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | N-6His |
Target Protein Sequence | GIAIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
Expression Range | 24-155aa(T26A) |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 15.9 kDa |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation. Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites. In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines. In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells. Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance. Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation. Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection. Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis. As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release. In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers. Involved in antiviral host defense through various mechanisms. Enhances immunity against West Nile virus by promoting T cell cytotoxicity. May play a beneficial role in influenza A virus (H5N1) infection by enhancing B cell recruitment and immune response in the lung. Contributes to influenza A virus (H1N1) clearance by driving the differentiation of B-1a B cells, providing for production of virus-specific IgM antibodies at first line of host defense. |
Subcellular Location | Secreted. |
Protein Families | IL-17 family |
Database References | |
Tissue Specificity | Expressed in memory Th17 cells (at protein level). |
Gene Functions References
- that proliferation potential-related protein promotes esophageal cancer cell proliferation and migration, and suppresses apoptosis by mediating the expression of p53 and IL-17 PMID: 30223275
- The pooled estimate revealed an association between IL-17A rs2275913 polymorphism and the risk of gastric cancer (GC) under all genetic models (A vs. G, OR 1.187, 95% CI 1.086-1.297, P < 0.001; GA vs. GG, OR 1.108, 95% CI 1.008-1.218, P = 0.033; AA vs. GG, OR 1.484, 95% CI 1.236-1.781, P < 0.001), while no evidence of association was found with IL-17A rs3748067 or IL-17F rs763780 polymorphisms. PMID: 29860554
- Over-expression of IL-17 and IL-27 are involved in the pathogenesis of liver damage in children with human cytomegalovrius infection. PMID: 30022757
- IL23 and IL17 have roles in the pathogenesis of Tunisian pemphigus foliaceus PMID: 30116153
- our findings supported the association between IL-17 SNPs and the risk of asthma in Chinese Han population from central China. GA genotype of rs3748067 and the C carries (CT+CC) of rs763780 were associated with a higher risk of asthma PMID: 30036556
- IL17A and HPSE may promote tumor angiogenesis and cell proliferation and invasion in cervical cancer, possibly via the NF-kappaB signaling pathway. PMID: 30066843
- the results suggest that IL17A (rs2275913) polymorphism is associated with the development of rheumatic heart disease in South Indian population PMID: 29985710
- This study demonstrated the alteration of IL-17 levels in aseptic non-vasculitic cerebral sinovenous thrombosis PMID: 30246697
- In this Brazilian population, TNF and IL17 gene polymorphisms responsible for the expression of important inflammatory cytokines were associated with overall spondyloarthritis and, specifically, with ankylosing spondylitis and psoriatic arthritis, regardless of gender and HLA-B27 PMID: 29849482
- The single nucleotide polymorphism rs2275913 in the IL-17A gene is associated with susceptibility to viral myocarditis. PMID: 29530464
- IL-17A197AA polymorphism is associated with the risk of colorectal cancer. PMID: 29970680
- our findings demonstrated that the AA genotype from the IL-17A rs2275913 SNP is positively associated with protection to active tuberculosis but related to higher disease severity in the Argentinean population. PMID: 28098168
- Our results from experiments suggest that the effects of IL-17 mediate activation of STAT3 signaling in breast cancer cells. Taken together, our study shows that myeloid-derived suppressor cells can be a new type of prognostic marker in breast cancer patients. Targeting IL-17/Stat3 signaling may be a promising strategy for BC treatment. PMID: 29655056
- This study draws two main conclusions: 1) The presence of IL-17 polymorphism rs2275913 is closely related to a more severe form of the disease and as a result, a higher number of disease-modifying anti rheumatic drugs required to control it, 2) The presence of IL-17 polymorphism rs2275913 may confer a risk of developing rheumatoid arthritis in Mexican carriers PMID: 28379210
- Polymorphisms of IL-17 are associated with host susceptibility to some bacterial pathogen. [review] PMID: 29345518
- secreted IL-17A is not responsible for the second hit in acute pancreatitis PMID: 29422392
- In carriage, an increased IL-17 and IFN-gamma levels were observed following stimulation with S. aureus strains. PMID: 29311230
- IL17A G197A is associated with a higher susceptibility of developing OLP and these patients seem to present a considerable increase in IL17A serum levels. PMID: 28741807
- These findings highlight a regulatory pathway of Tiam1/Rac1 in Th17 cells and suggest that it may be a therapeutic target in multiple sclerosis. PMID: 27725632
- Interleukin 17A (IL-17[G197G]) was associated with preterm birth (PTB), and the PTB group had lower IL-17A expression compared to the full-term group . PMID: 29431293
- In studies of mouse and human pancreatic tumors and precursors, we found that immune cell-derived IL17 regulated development of tuft cells and stem cell features of pancreatic cancer cells via increased expression of DCLK1, POU2F3, ALDH1A1, and IL17RC. PMID: 29604293
- Expression of miR-135a in the cancer cells isolated from nasopharyngeal tumors was significantly lower than that in NP69 cells, and suppression of IL-17 by miR-135a mimic resulted in significant inhibition of NPC cell proliferation. PMID: 29734196
- The expression of IL-17 and IL-12 in patients with lupus miliaris disseminatus faciei is reported in patients and healthy controls. PMID: 27515793
- these findings suggest that the variants +2199 A/C IL-23R and -197 G/A IL-17A could contribute to rheumatoid arthritis development in the studied population PMID: 28547498
- IL-17A rs2275913 polymorphism did not seem to influence RA susceptibility in Tunisian population. PMID: 29584788
- results suggest that IL-17A stimulated keratinocytes activated PI3K/AKT/mTOR signaling and inhibited autophagy by simultaneously inhibiting autophagosome formation and enhancing autophagic flux. PMID: 29432814
- In the present review, we have discussed the cellular sources, modes of action and regulation of IL-17 and IL-33 in the context of hypersensitive diseases [Review] PMID: 29153708
- Findings identify interleukin-17A as a potential mediator of neuroanatomical remodeling of the gut innervation during inflammatory bowel diseases. PMID: 28560787
- This review discusses recent discoveries related to the pro-inflammatory cytokine IL17A, and its potential role in the pathogenesis of COPD. We propose that an intervention strategy targeting IL-17 signaling offers an exciting opportunity to mitigate inflammatory processes, and prevent the progression of tissue pathologies associated with COPD [Review] PMID: 28438639
- rs2275913 gene polymorphism associated with a risk of Bacillus-Calmette-Guerin osteitis after vaccination PMID: 28731539
- Study shows that higher baseline levels of Interleukin 17 are selectively associated with greater symptomatic reduction in depressed patients treated with bupropion-SSRI combination. PMID: 28698115
- IL-23/IL-17 axis and biochemical markers in the pathogenesis of Type 2 Diabetes PMID: 28757426
- Higher levels of TGF-beta mRNA were observed in biopsies taken from healthy controls, and the IL-23 mRNA levels were significantly increased in the peri-implantitis group (P < 0.0001). No differences in IL-17 mRNA levels were observed between the two groups (P > 0.05). PMID: 27062688
- Studied interleukin-17 (IL-17) expression levels in blood and skin of atopic dermatitis (AD) patients and controls. PMID: 28279075
- semen IL-17 and IL-18 levels in diabetes mellitus males were significantly higher than those in normal males and were positively correlated with blood glucose level and sperm DNA fragmentation index PMID: 28858634
- clinical significance of IL-17 and IL-23 in the pathogenesis of different types of gastric neoplasms in humans, is reported. PMID: 27869179
- The IL-17A (-832A/G) polymorphism was not associated with accelerated silicosis. PMID: 28481151
- IL-17A was significantly upregulated in patients with the uncontrolled and refractory status. Therefore, IL-17A may play important roles in asthmatic exacerbation, and its high level, in combination with upregulated Th2 and other cytokines, may indicate the refractory endotype of asthma. PMID: 28840844
- results suggest that IL17A participates in the immune response of the human host against M. tuberculosis through the activation of the autophagy process in correlation with the severity of the disease PMID: 28581888
- developed ultrasensitive methods for measuring IL-17A and IL-17F in human serum samples and found that serum from psoriasis patients had higher and a broader range of concentrations of both IL-17 proteins compared to healthy volunteers PMID: 28534291
- SNPs of rs3819024 in IL-17A and rs763780 in IL-17F were weakly related to a prognosis of tuberculosis. PMID: 27339100
- this study shows that aberrant NKG2D expression with IL-17 production of CD4+ T subsets in patients with type 2 diabetes PMID: 27168217
- Luciferase assay using the 5'-UTR of the IL-17 F gene revealed transcriptional regulation. Induced IL-17 F production was further confirmed at the protein level by ELISA. Smad1/5/8 inhibitor pretreatment decreased IL-17 F expression levels in the cells. PMID: 28812969
- Study shows increased IL-17A expression in early tendinopathy and proposes IL-17A as an inflammatory regulator in tendon remodeling. PMID: 27263531
- Several studies identified IL-17A as a pro-inflammatory player in atherosclerosis while its expression was associated with increased inflammation and plaque vulnerability in human atherosclerotic lesions. Moreover, IL-17A induced a pro-inflammatory, pro-thrombotic, plaque-destabilizing, and cell-attracting response of the inflammatory milieu of human plaque tissue samples. [review] PMID: 28034277
- asymmetric cell divisions in psoriasis are IL17A-dependent. PMID: 28600817
- Serum IL-23 and IL-17 levels were elevated in patients with aneurysmal subarachnoid hemorrhage (aSAH) showing upregulation of IL-23/IL-17 inflammatory axis after aSAH. Serum IL-23 and IL-17 showed differential correlations with post hemorrhagic complications and no correlation with clinical outcome. PMID: 28609751
- Data showed that IL-17A levels were sustained in respiratory samples from cystic fibrosis patients infected by P. aeruginosa. IL-17 mediated-immunity plays a double-edged found during chronic airways infection: in one hand, it contributes to the control of P. aeruginosa burden, modulating host resistance, while, on the other, it alters host tolerance, propagating exacerbated pulmonary neutrophilia and tissue remodeling. PMID: 27189736
- gamma delta T cells, rather than Th17cells, are the principal producers of IL-17 in acute gouty arthritis patients during the acute gout flares. PMID: 29476737
- high expression of both IL17A and IL32 leads to enhancement of T cell responses in breast tumors PMID: 28470472