Recombinant Human Interleukin-17A (IL17A) Protein (His), Active

Name: Recombinant Human Interleukin-17A (IL17A) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05341P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, High-purity interleukins & receptors for research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Interleukin-17A (IL17A) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells is less than 500 ng/ml.
Uniprotkb	Q16552
Target Symbol	IL17A
Synonyms	CTLA 8; CTLA-8; CTLA8; cytotoxic T lymphocyte associated antigen 8; Cytotoxic T lymphocyte associated protein 8; Cytotoxic T lymphocyte associated serine esterase 8; Cytotoxic T-lymphocyte-associated antigen 8; IL 17; IL 17A; IL-17; IL-17A; IL17; IL17_HUMAN; Il17a; Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8); interleukin 17A; Interleukin-17A; interleukin17; Interleukin17A; OTTHUMP00000016597; OTTMUSP00000046003
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His
Complete Sequence	GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Expression Range	24-155aa
Protein Length	Full Length of Mature Protein
Mol. Weight	15.9 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.

Target Details

Target Function	Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation. Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites. In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines. In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells. Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance. Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation. Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection. Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis. As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release. In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers. Involved in antiviral host defense through various mechanisms. Enhances immunity against West Nile virus by promoting T cell cytotoxicity. May play a beneficial role in influenza A virus (H5N1) infection by enhancing B cell recruitment and immune response in the lung. Contributes to influenza A virus (H1N1) clearance by driving the differentiation of B-1a B cells, providing for production of virus-specific IgM antibodies at first line of host defense.
Subcellular Location	Secreted.
Protein Families	IL-17 family
Database References	HGNC: 5981 OMIM: 603149 KEGG: hsa:3605 STRING: 9606.ENSP00000344192 UniGene: PMID: 30223275 The pooled estimate revealed an association between IL-17A rs2275913 polymorphism and the risk of gastric cancer (GC) under all genetic models (A vs. G, OR 1.187, 95% CI 1.086-1.297, P < 0.001; GA vs. GG, OR 1.108, 95% CI 1.008-1.218, P = 0.033; AA vs. GG, OR 1.484, 95% CI 1.236-1.781, P < 0.001), while no evidence of association was found with IL-17A rs3748067 or IL-17F rs763780 polymorphisms. PMID: 29860554 Over-expression of IL-17 and IL-27 are involved in the pathogenesis of liver damage in children with human cytomegalovrius infection. PMID: 30022757 IL23 and IL17 have roles in the pathogenesis of Tunisian pemphigus foliaceus PMID: 30116153 our findings supported the association between IL-17 SNPs and the risk of asthma in Chinese Han population from central China. GA genotype of rs3748067 and the C carries (CT+CC) of rs763780 were associated with a higher risk of asthma PMID: 30036556 IL17A and HPSE may promote tumor angiogenesis and cell proliferation and invasion in cervical cancer, possibly via the NF-kappaB signaling pathway. PMID: 30066843 the results suggest that IL17A (rs2275913) polymorphism is associated with the development of rheumatic heart disease in South Indian population PMID: 29985710 This study demonstrated the alteration of IL-17 levels in aseptic non-vasculitic cerebral sinovenous thrombosis PMID: 30246697 In this Brazilian population, TNF and IL17 gene polymorphisms responsible for the expression of important inflammatory cytokines were associated with overall spondyloarthritis and, specifically, with ankylosing spondylitis and psoriatic arthritis, regardless of gender and HLA-B27 PMID: 29849482 The single nucleotide polymorphism rs2275913 in the IL-17A gene is associated with susceptibility to viral myocarditis. PMID: 29530464 IL-17A197AA polymorphism is associated with the risk of colorectal cancer. PMID: 29970680 our findings demonstrated that the AA genotype from the IL-17A rs2275913 SNP is positively associated with protection to active tuberculosis but related to higher disease severity in the Argentinean population. PMID: 28098168 Our results from experiments suggest that the effects of IL-17 mediate activation of STAT3 signaling in breast cancer cells. Taken together, our study shows that myeloid-derived suppressor cells can be a new type of prognostic marker in breast cancer patients. Targeting IL-17/Stat3 signaling may be a promising strategy for BC treatment. PMID: 29655056 This study draws two main conclusions: 1) The presence of IL-17 polymorphism rs2275913 is closely related to a more severe form of the disease and as a result, a higher number of disease-modifying anti rheumatic drugs required to control it, 2) The presence of IL-17 polymorphism rs2275913 may confer a risk of developing rheumatoid arthritis in Mexican carriers PMID: 28379210 Polymorphisms of IL-17 are associated with host susceptibility to some bacterial pathogen. [review] PMID: 29345518 secreted IL-17A is not responsible for the second hit in acute pancreatitis PMID: 29422392 In carriage, an increased IL-17 and IFN-gamma levels were observed following stimulation with S. aureus strains. PMID: 29311230 IL17A G197A is associated with a higher susceptibility of developing OLP and these patients seem to present a considerable increase in IL17A serum levels. PMID: 28741807 These findings highlight a regulatory pathway of Tiam1/Rac1 in Th17 cells and suggest that it may be a therapeutic target in multiple sclerosis. PMID: 27725632 Interleukin 17A (IL-17[G197G]) was associated with preterm birth (PTB), and the PTB group had lower IL-17A expression compared to the full-term group . PMID: 29431293 In studies of mouse and human pancreatic tumors and precursors, we found that immune cell-derived IL17 regulated development of tuft cells and stem cell features of pancreatic cancer cells via increased expression of DCLK1, POU2F3, ALDH1A1, and IL17RC. PMID: 29604293 Expression of miR-135a in the cancer cells isolated from nasopharyngeal tumors was significantly lower than that in NP69 cells, and suppression of IL-17 by miR-135a mimic resulted in significant inhibition of NPC cell proliferation. PMID: 29734196 The expression of IL-17 and IL-12 in patients with lupus miliaris disseminatus faciei is reported in patients and healthy controls. PMID: 27515793 these findings suggest that the variants +2199 A/C IL-23R and -197 G/A IL-17A could contribute to rheumatoid arthritis development in the studied population PMID: 28547498 IL-17A rs2275913 polymorphism did not seem to influence RA susceptibility in Tunisian population. PMID: 29584788 results suggest that IL-17A stimulated keratinocytes activated PI3K/AKT/mTOR signaling and inhibited autophagy by simultaneously inhibiting autophagosome formation and enhancing autophagic flux. PMID: 29432814 In the present review, we have discussed the cellular sources, modes of action and regulation of IL-17 and IL-33 in the context of hypersensitive diseases [Review] PMID: 29153708 Findings identify interleukin-17A as a potential mediator of neuroanatomical remodeling of the gut innervation during inflammatory bowel diseases. PMID: 28560787 This review discusses recent discoveries related to the pro-inflammatory cytokine IL17A, and its potential role in the pathogenesis of COPD. We propose that an intervention strategy targeting IL-17 signaling offers an exciting opportunity to mitigate inflammatory processes, and prevent the progression of tissue pathologies associated with COPD [Review] PMID: 28438639 rs2275913 gene polymorphism associated with a risk of Bacillus-Calmette-Guerin osteitis after vaccination PMID: 28731539 Study shows that higher baseline levels of Interleukin 17 are selectively associated with greater symptomatic reduction in depressed patients treated with bupropion-SSRI combination. PMID: 28698115 IL-23/IL-17 axis and biochemical markers in the pathogenesis of Type 2 Diabetes PMID: 28757426 Higher levels of TGF-beta mRNA were observed in biopsies taken from healthy controls, and the IL-23 mRNA levels were significantly increased in the peri-implantitis group (P < 0.0001). No differences in IL-17 mRNA levels were observed between the two groups (P > 0.05). PMID: 27062688 Studied interleukin-17 (IL-17) expression levels in blood and skin of atopic dermatitis (AD) patients and controls. PMID: 28279075 semen IL-17 and IL-18 levels in diabetes mellitus males were significantly higher than those in normal males and were positively correlated with blood glucose level and sperm DNA fragmentation index PMID: 28858634 clinical significance of IL-17 and IL-23 in the pathogenesis of different types of gastric neoplasms in humans, is reported. PMID: 27869179 The IL-17A (-832A/G) polymorphism was not associated with accelerated silicosis. PMID: 28481151 IL-17A was significantly upregulated in patients with the uncontrolled and refractory status. Therefore, IL-17A may play important roles in asthmatic exacerbation, and its high level, in combination with upregulated Th2 and other cytokines, may indicate the refractory endotype of asthma. PMID: 28840844 results suggest that IL17A participates in the immune response of the human host against M. tuberculosis through the activation of the autophagy process in correlation with the severity of the disease PMID: 28581888 developed ultrasensitive methods for measuring IL-17A and IL-17F in human serum samples and found that serum from psoriasis patients had higher and a broader range of concentrations of both IL-17 proteins compared to healthy volunteers PMID: 28534291 SNPs of rs3819024 in IL-17A and rs763780 in IL-17F were weakly related to a prognosis of tuberculosis. PMID: 27339100 this study shows that aberrant NKG2D expression with IL-17 production of CD4+ T subsets in patients with type 2 diabetes PMID: 27168217 Luciferase assay using the 5'-UTR of the IL-17 F gene revealed transcriptional regulation. Induced IL-17 F production was further confirmed at the protein level by ELISA. Smad1/5/8 inhibitor pretreatment decreased IL-17 F expression levels in the cells. PMID: 28812969 Study shows increased IL-17A expression in early tendinopathy and proposes IL-17A as an inflammatory regulator in tendon remodeling. PMID: 27263531 Several studies identified IL-17A as a pro-inflammatory player in atherosclerosis while its expression was associated with increased inflammation and plaque vulnerability in human atherosclerotic lesions. Moreover, IL-17A induced a pro-inflammatory, pro-thrombotic, plaque-destabilizing, and cell-attracting response of the inflammatory milieu of human plaque tissue samples. [review] PMID: 28034277 asymmetric cell divisions in psoriasis are IL17A-dependent. PMID: 28600817 Serum IL-23 and IL-17 levels were elevated in patients with aneurysmal subarachnoid hemorrhage (aSAH) showing upregulation of IL-23/IL-17 inflammatory axis after aSAH. Serum IL-23 and IL-17 showed differential correlations with post hemorrhagic complications and no correlation with clinical outcome. PMID: 28609751 Data showed that IL-17A levels were sustained in respiratory samples from cystic fibrosis patients infected by P. aeruginosa. IL-17 mediated-immunity plays a double-edged found during chronic airways infection: in one hand, it contributes to the control of P. aeruginosa burden, modulating host resistance, while, on the other, it alters host tolerance, propagating exacerbated pulmonary neutrophilia and tissue remodeling. PMID: 27189736 gamma delta T cells, rather than Th17cells, are the principal producers of IL-17 in acute gouty arthritis patients during the acute gout flares. PMID: 29476737 high expression of both IL17A and IL32 leads to enhancement of T cell responses in breast tumors PMID: 28470472

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.