Recombinant Human Interleukin-15 (IL15), Active
Beta LifeScience
SKU/CAT #: BLC-05336P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Interleukin-15 (IL15), Active
Beta LifeScience
SKU/CAT #: BLC-05336P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Interleukin-15 (IL15), Active is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is 40-200pg/ml. The ED50 for this effect is typically 99.94 pg/mL.(Novoprotein) The ED50 for this effect is typically 346.61pg/mL. (R) |
| Uniprotkb | P40933 |
| Target Symbol | IL15 |
| Synonyms | IL 15; IL-15; IL15; IL15_HUMAN; Interleukin 15; Interleukin-15; Interleukin15; MGC9721 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Complete Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Expression Range | 49-162aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 12.5 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0 |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
| Target Function | Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL15 requires interaction of IL15 with components of the IL2 receptor, including IL2RB and probably IL2RG but not IL2RA. In neutrophils, stimulates phagocytosis probably by signaling through the IL15 receptor, composed of the subunits IL15RA, IL2RB and IL2RG, which results in kinase SYK activation. |
| Subcellular Location | [Isoform IL15-S48AA]: Secreted.; [Isoform IL15-S21AA]: Cytoplasm. Nucleus. Note=IL15-S21AA is not secreted, but rather is stored intracellularly, appearing in the nucleus and cytoplasmic components. |
| Protein Families | IL-15/IL-21 family |
| Database References | HGNC: 5977 OMIM: 600554 KEGG: hsa:3600 STRING: 9606.ENSP00000296545 UniGene: PMID: 29619608 |
