Recombinant Human Interleukin-13 (IL13) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05343P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Interleukin-13 (IL13) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05343P
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, High-purity interleukins & receptors for research, High-quality cytokines for advanced research, High-quality recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Interleukin-13 (IL13) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 5 ng/ml. |
| Uniprotkb | P35225 |
| Target Symbol | IL13 |
| Synonyms | Allergic rhinitis; ALRH; BHR 1; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; IL-13; Il13; IL13_HUMAN; Interleukin 13; Interleukin-13; interleukin13; MGC116786; MGC116788; MGC116789; NC 30; NC30; P 600; P600 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-6His |
| Complete Sequence | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
| Expression Range | 35-146aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 13.4 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered PBS,PH7.4 |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
| Target Function | Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages. |
| Subcellular Location | Secreted. |
| Protein Families | IL-4/IL-13 family |
| Database References | HGNC: 5973 OMIM: 147683 KEGG: hsa:3596 STRING: 9606.ENSP00000304915 UniGene: PMID: 30132525 |
