Recombinant Human Interleukin-13 (IL13) Protein (hFc-Myc)
Beta LifeScience
SKU/CAT #: BLC-07873P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Interleukin-13 (IL13) Protein (hFc-Myc)
Beta LifeScience
SKU/CAT #: BLC-07873P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Interleukin-13 (IL13) Protein (hFc-Myc) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P35225 |
Target Symbol | IL13 |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-hFc-Myc |
Target Protein Sequence | TVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDL |
Expression Range | 21-132aa |
Protein Length | Partial |
Mol. Weight | 42.0 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages. |
Subcellular Location | Secreted. |
Protein Families | IL-4/IL-13 family |
Database References | |
Associated Diseases | Allergic rhinitis (ALRH) |
Gene Functions References
- forced expression of miR16 blocked NFkappaB signaling by decreasing the expression of nuclear pp65 and pIkappaBalpha, as well as increasing the expression of IkappaBalpha in IL13treated nasal epithelial cells. PMID: 30132525
- These studies suggest that cellular NO excretion by the healthy epithelial mucosa is subject to considerable individual variability and may be significantly elevated among some individuals in the presence of IL-13 PMID: 29380192
- This study demonstrates that IL-13 serum levels are elevated in patients with insulin resistance without showing correlation with parameters of low-grade systemic inflammation. PMID: 29675435
- Our findings suggest that IL-13 SNP rs20541 is significantly associated with AR risk in Asians but not in Caucasians. [meta-analysis] PMID: 29687183
- genetic variants in IL-13, especially h0011 haplotype increased the risk of the prevalence of aggregate bronchitic symptoms in non-asthmatic children. It may also modify the effects of exposure to air pollutants on the prevalence of aggregate bronchitic symptoms. PMID: 29456163
- meta-analysis indicates 1112 polymorphism may be associated with susceptibility to periodontitis PMID: 29415708
- These results demonstrate that histamine up-regulates the expression of TLR3 and secretion of IL-13 and MCP-1 in mast cells, thus identifying a new mechanism for the histamine inducing allergic response. PMID: 29742501
- IL-13 enhances mesenchymal transition of pulmonary artery endothelial cells via down-regulation of miR-424/miR-503 in vitro. PMID: 29102771
- Silencing DUOX1 by siRNA attenuated IL-13-mediated increases in superoxide, but did not reduce autophagy activities. PMID: 28982074
- this is the first study using population epidemiological methods to elucidate the role of gut microbiota-related dietary factors and polymorphisms in miRNA-binding site in IL13 in CRC. PMID: 28537887
- Substitutions in the central immune regulator IL13 correspond to a polymorphism linked to asthma susceptibility in humans. PMID: 28854632
- IL13 polymorphism rs1295686 (in complete linkage disequilibrium with functional variant rs20541) is associated with challenge-proven food allergy. PMID: 28544327
- SOCS1 inhibits epithelial IL-13 signalling, supporting its key role in regulating Th2-driven eosinophilia in severe asthma PMID: 27338192
- IL-13, IL-13Ralpha1, STAT6 and ZEB1 have roles in promoting epithelial-mesenchymal transition and aggressiveness of colorectal cancer cells PMID: 27533463
- This meta-analysis suggests that the T allele of rs1800925 is associated with the increased risk of COPD in both Asians and Caucasians, whereas rs20541 is associated with the risk of COPD in Caucasians but not in Asians. PMID: 29381928
- the IL13-1112 C/T (rs1800925) polymorphism does not predict responsiveness to neoadjuvant chemoradiotherapy or prognosis of Chinese Han patients with locally advanced rectal cancer . PMID: 27167201
- The results of this study demonstrate that IL13QD can serve as an ex vivo marker for glioma stem cells and exosomes that can inform diagnosis and prognosis of patients harboring malignant disease. PMID: 28583903
- Different genotype profiles of IL13 gene seem to influence the clinical pattern of disease expression mainly confined to the upper airways, as rhinitis, or including the lower airways, as asthma PMID: 27561723
- secretion of IL-13 and amphiregulin suggests Intrahepatic Innate lymphoid cells may be recruited to promote resolution and repair and thereby they may contribute to ongoing fibrogenesis in liver disease. PMID: 29261670
- These findings demonstrate that NF-kappaB-mediated transcriptional mechanisms are critically involved in the IL-1beta-mediated IL-17C induction, and that IL-13 negatively regulates this induction by suppressing NF-kappaB-based transcriptional activation. PMID: 29203240
- These results suggested that IL-13 +1923C/T polymorphism contributed to the development of asthma. PMID: 28057889
- IL13 AA of rs20541 and STAT4 TT of rs925847 are potential genomic biomarkers for predicting lower pulmonary function. The administration of high-dose ICSs to asthmatic patients with genetic variants of IL13 AA may inhibit the advancement of airway remodelling. The genetic variants of STAT4 TT did not respond to high-dose ICSs. PMID: 26765219
- The diagnostic performance of sputum IL-13 was superior to both sputum eosinophils and FeNO levels for the identification of well-controlled asthma. Sputum IL-13 levels could serve as a useful biomarker for asthma control assessment. PMID: 26990030
- 15LO1 inhibition (by short interfering RNA and chemical inhibitor) decreased IL-13-induced forkhead box protein A3 (FOXA3) expression and enhanced FOXA2 expression. These changes were associated with reductions in both mucin 5AC and periostin. PMID: 28723225
- Clarithromycin suppressed IL-13-induced periostin production in human lung fibroblasts, in part by inhibiting STAT6 phosphorylation. This suggests a novel mechanism of the immunomodulatory effect of clarithromycin in asthmatic airway inflammation and fibrosis. PMID: 28219384
- Simvastatin reversed IL-13-suppressed adenosine deaminase activity, leading to the down-regulation of adenosine signaling and inhibition osteopontin expression through the direct inhibition of IL-13-activated STAT6 pathway in COPD. PMID: 27557561
- IL-13 suppressed cyp27b1 expression in CD14(+) cells. IL-13 increased expression of miR-19a in CD14(+) cells. IL-13 suppresses cyp27b1 expression in peripheral CD14(+) cells via up regulating miR-19a expression. PMID: 27381199
- Leptin knockdown suppressed MUC5AC production and secretion induced by IL-13 in human bronchial epithelial cells. PMID: 28942146
- demonstrate a strong association between the ratio of Acinetobacter to Proteobacteria and IL-13 production and the probability of IL-13 production after allergen exposure. IL-13 concentrations in serum were also significantly correlated with the diversity of bacterial DNA. Together, these results underscore the relationship between immune responses to allergens and bacterial exposure during perinatal development. PMID: 28443674
- These observations suggest that mechanical stretch may induce an influx of Ca(2+) and up-regulation of IL-13 and MMP-9 expression in 16HBE cells via activation of TRPC1 PMID: 27986325
- The presented data substantiate the hypothesis that claudin-18 is a central barrier-forming component of tight junctions and show that IL-13 downregulates claudin-18. These data also suggest that the loss of claudin-18 is associated with increased sensitization to aeroantigens and airway responsiveness PMID: 27215490
- investigated the role of six potentially functional variants of the IL4, IL13, and IL4R genes in gastrointestinal cancer; both IL13 rs20541 and rs1800925 were not associated with gastrointestinal cancer risk for any of the genetic models and subgroup analyses [meta-analysis] PMID: 28142034
- IL13 in bronchial epithelial cells and bronchial alveolar lavage fluid, rather than RAD50, IL4, or IL5, is more likely to be the asthma susceptibility gene. PMID: 27050946
- We also found that the activation of H4R caused the release of IL-13 and RANTES on human mast cells.these data demonstrate that the H4R activates divergent signaling pathways to induce cytokine and chemokine production in human mast cells PMID: 27400655
- IL13 Arg130Gln genotypes can play a role in genetic susceptibility to allergy via regulation of serum total IgE levels and affecting IFN-gamma gene expression. PMID: 28054352
- The GG genotype of IL-13 130A/G cytokine gene might be involved in the induced production of total IgE and IL-13 cytokine serum levels suggesting IL-13 may be important in the signalling of asthma. PMID: 28083766
- STAT6-TMEM16A-ERK1/2 signal pathway and TMEM16A channel activity are required for the IL-13-induced TMEM16A mediated mucus production PMID: 27588910
- TGF-beta- and IL-13-producing mast cells might be key players in the development of bone marrow fibrosis. PMID: 28159675
- this study shows that low expression of tristetraprolin is associated with glioma growth and metastasis by targeting IL-13 PMID: 27424080
- this study shows that IL-13 gene polymorphism is associated with allergic rhinitis and/or allergic conjunctivitis in Finnish asthma patients PMID: 28273659
- The presence of higher IL-13 and IL-17 serum levels in patients, compared with those of controls, confirms that these markers, found with high specificity, might be involved in the pathogenesis of eRA. IL-13 and IL-17 might be of better usefulness in the prediction of eRA activity status than IgM-RF and anti-CCP. PMID: 27579330
- The IL13 rs20541 T allele and IL28B rs8099917 GG genotype are negative predictors of survival in patients on renal replacement therapy PMID: 26039912
- these data suggest that microRNA-143 suppresses IL-13 activity and inflammation through targeting of IL-13Ralpha1 in epidermal keratinocytes PMID: 27048505
- Platycodin D inhibits IL-13-induced expression of inflammatory cytokines and mucus in nasal epithelial cells by inhibiting the activation of NF-kappaB and MAPK signaling pathways. PMID: 27780139
- A negative correlation between IL-13Ra2 and IL-13 was found during early infection of human schistosomiasis, suggesting an increase in cytokine in early fibrosis. PMID: 27507682
- autophagy is essential for airway mucus secretion in a type 2, IL13-dependent immune disease process. PMID: 26062017
- childhood asthma is associated with gene polymorphism; meta-analysis PMID: 26534891
- PLD1 activation enhanced binding of ROCK1 to ATF-2 and leads to increased expression of IL-13 PMID: 26335962
- DNA hypomethylation of IL13 gene may be associated with increased risk of allergic rhinitis from house dust mite sensitization PMID: 26399722
- Our in vitro and in vivo data indicate close cooperation between mechanical and inflammatory stimuli on TF expression and release of TF-positive extracellular vesicles in the lungs, which may contribute to pathophysiology of asthma PMID: 26407210