Recombinant Human Interleukin-12 Subunit Beta (IL12B) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08399P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Interleukin-12 Subunit Beta (IL12B) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08399P
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, High-purity interleukins & receptors for research, High-quality cytokines for advanced research, High-quality recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Interleukin-12 Subunit Beta (IL12B) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P29460 |
| Target Symbol | IL12B |
| Synonyms | CLMF ; CLMF p40; CLMF2; Cytotoxic lymphocyte maturation factor 40 kDa subunit; IL 12B; IL-12 subunit p40; IL-12B; IL12 p40; IL12B; IL12B_HUMAN; IMD28; IMD29; Interleukin 12 beta chain; Interleukin 12 p40; Interleukin-12 subunit beta; NK cell stimulatory factor chain 2; NKSF ; NKSF2 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
| Expression Range | 23-328aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 61.7kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.; Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis. |
| Subcellular Location | Secreted. |
| Protein Families | Type I cytokine receptor family, Type 3 subfamily |
| Database References | HGNC: 5970 OMIM: 161561 KEGG: hsa:3593 STRING: 9606.ENSP00000231228 UniGene: PMID: 29763989 |
