Recombinant Human Interleukin-12 Receptor Subunit Beta-1 (IL12RB1) Protein (hFc-Avi)

Name: Recombinant Human Interleukin-12 Receptor Subunit Beta-1 (IL12RB1) Protein (hFc-Avi)
Brand: Beta LifeScience
SKU: BLC-00233P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, Avi-tagged proteins, Buy cytokines, chemokines, and growth factors for research online, High-purity interleukins & receptors for research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Interleukin-12 Receptor Subunit Beta-1 (IL12RB1) Protein (hFc-Avi) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Activity	Not tested.
Uniprotkb	P42701
Target Symbol	IL12RB1
Synonyms	(IL-12 receptor subunit beta-1)(IL-12R subunit beta-1)(IL-12R-beta-1)(IL-12RB1)(IL-12 receptor beta component)(CD antigen CD212)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	C-hFc-Avi
Target Protein Sequence	CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSD
Expression Range	24-545aa
Protein Length	Partial
Mol. Weight	85.5 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	Type I cytokine receptor family, Type 2 subfamily
Database References	HGNC: 5971 OMIM: 601604 KEGG: hsa:3594 STRING: 9606.ENSP00000403103 UniGene: PMID: 28450854 To our knowledge, this is the third patient with Mendelian susceptibility to mycobacterial disease due to IL-12Rbeta1 deficiency complicated with enteropathy and hypogammaglobulinemia and the first case of this disease to be described in Colombia. PMID: 28865061 Th17 cells expressed consistent high levels of the IL-12Rbeta1 subunit, which appeared a better predictor of responsiveness to IL-23 than the expression of the IL-23R subunit. PMID: 27645493 Truncated IL12rbeta1/Fc is a novel fusion protein for specific binding multiple forms of p40 subunit to exert potent anti-inflammatory effects. PMID: 26384304 the introduction of RNA-DNA differences into an individual's IL12RB1 mRNA repertoire is a novel determinant of IL12/23 sensitivity. PMID: 26621740 we describe cosegregation of a heterozygous germline defect in IL12RB1 and gastric cancer development in a family with IL-12Rbeta1 deficiency PMID: 25467645 individual variability in IL12RB1 function is introduced at the epigenetic, genomic polymorphism, and mRNA splicing levels [review] PMID: 25516297 Early coupled up-regulation of IL12RB1 in CD8+ central memory and effector T cells result in better clinical outcomes in liver transplant recipients. PMID: 25603847 Strong association of rs438421 in the IL-12Rbeta1 gene with Allergic rhinitis in Chinese was demonstrated . The GG genotype of rs438421 was validated as stimulus factors to AR, while the AG genotype of rs438421 was confirmed as protective factors to AR. PMID: 24997981 The IL-23/IL-23R/IL-12Rbeta1 complex formation does not follow the classical "site I-II-III" architectural paradigm. PMID: 25371211 IL-12Rbeta1 expression on the cell surface was negligible or absent. PMID: 23952477 SNP rs2305743 in IL12RB1 was associated with systemic sclerosis. PMID: 25199642 A review of the molecular genetics of all known IL12RB1 mutations and variants. PMID: 23864330 IL12Rbeta1 expression is lacking on CD8+ T and natural killer (NK) cell surface in a 33-year-old patient with Mycobacterium tilburgii infection. PMID: 24114017 Results suggest a relationship between certain TNF-alpha and IL12B polymorphisms and the short-term response to anti-TNF-alpha drugs. PMID: 23662788 Although SNPs of the IL12RB1 gene do not seem to convey some genetic predisposition for hidradenitis suppurativa, they impact considerably on the clinical phenotype of the disease. PMID: 23557799 IL12RB1 is located on autosomal chromosome 19 at location 19p13.1 and comprises exons 1-9, 9b, and 10-17. IL12RB1 isoform 2 is distinct from isoform 1 and is derived from alternate 3' exon inclusion. PMID: 23024274 IL12RB1 polymorphisms may affect IL-12 and IL-23 binding and downstream effects, which are critical cytokines in the cell-mediated immune response to measles vaccine. PMID: 22504412 Our data suggest that the effect of breast-feeding on food sensitization (FS) was modified by SNPs in the IL12RB1, TLR9, and TSLP genes both individually and jointly. PMID: 21689850 first cases in Mexico of patients with BCG disease traced to a mutation in the IL12RB1 gene, with a fatal outcome PMID: 20171917 autosomal recessive IL12Rbeta1 deficiency who suffered from sepsis attributable to Klebsiella pneumoniae. PMID: 20855390 Coupled regulation of interleukin-12 receptor beta-1 of CD8+ central memory and CCR7-negative PMID: 20345976 rs438421 (IVS12+1266T/C) SNP and the haplotype CCA (rs375947, rs438421, and rs1870063) significantly associated with atopic dermatitis PMID: 20060272 A splice acceptor mutation affecting exon 15 of the IL-12R beta 1 subunit gene results in complete loss of surface expression of this subunit, and impairment of memory CD4 T cells with Th1 effector function. PMID: 12496448 Severe Mycobacterium bovis BCG infections in a large series of novel IL-12 receptor beta1 deficient patients and evidence for the existence of partial IL-12 receptor beta1 deficiency. PMID: 12594833 These data suggest that the R214-T365-R378 allele, i.e., variation in IL12RB1, contribute to tuberculosis susceptibility in the Japanese population. PMID: 12596048 impact of amino acid variations on the three-dimensional structure of the IL-12Rbeta1 protein PMID: 12671732 surface expression of nonfunctional IL-12Rbeta1 is related to an IL12RB1 mutation PMID: 15178580 IL12RB1 polymorphisms might influence the risk of development of pulmonary tuberculosis in adults PMID: 15243935 Interleukin-12 receptor beta 1 codon 378 gene polymorphism is not correlated with endometriosis development. PMID: 16084898 In individuals with the -111T/T genotype, reduced IL-12Rbeta1 expression may lead to increased Th2 cytokine production in the skin and contribute to the development of Atopic dermatitis and other subsequent allergic diseases. PMID: 16159888 Genetic variants of IL12RB1, at least in part, confer genetic susceptibility to TB, and are associated with the progression of the disease, in Japanese. PMID: 17284226 IL12B promoter heterozygosity was associated with protection from tuberculosis in BCG-vaccinated individuals, supporting the role that IL-23, of which IL12B encodes a subunit, plays in generation of memory T cells PMID: 17392024 A twofold increase in the percentage of CD4-resting T cells expressing IL-12Rbeta1 and IL-18Ralpha from HIV-1-infected patients; deregulation of the IL-12 and IL-18 pathways may play a role in the immunopathogenesis of HIV-1 infection. PMID: 17403771 data indicate that genetic variants of IL12RB1confer genetic susceptibility to SARS infection, but not necessary associated with the progression of the disease in Chinese population PMID: 18478121 IL-12Rbeta1 gene polymorphisms do not appear to be responsible for host susceptibility to nontuberculous mycobacterial lung disease in a Korean population. PMID: 18493823 IL-12Rbeta1- and STAT-3--dependent signals play a key role in the differentiation and/or expansion of human IL-17-producing T cell populations in vivo. PMID: 18591412 analysis of a known (c.1623_1624delGCinsTT) and a novel mutation (c.65_68delCTGC of exon2) of the Interleukin-12 Receptor-beta1 gene in a patient with a fatal case of relapsing cervical lymphadenopathy due to Mycobacterium avium [case report] PMID: 18940359 A common haplotype spanning 1.45-3.51Mb was shared by all chromosomes carrying mutation 1623_1624delinsTT, an IL12RB1 mutation, which results in Mendelian Susceptibility to Mycobacterial Diseases; mutation was not detected on 100 control chromosomes. PMID: 19460324 novel nonsense mutation in exon 4 results in protein deficiency and increased susceptibility to bacterial infections PMID: 19839503

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.