Recombinant Human Interleukin-1 Receptor Antagonist Protein (IL1RN) Protein (His)

Name: Recombinant Human Interleukin-1 Receptor Antagonist Protein (IL1RN) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08398P
Price: 418.4 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Interleukins and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Interleukin-1 Receptor Antagonist Protein (IL1RN) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P18510
Target Symbol	IL1RN
Synonyms	DIRA; F630041P17Rik; ICIL 1RA; ICIL-1RA; ICIL1RA; IL-1ra; IL-1ra3; IL-1RN; IL1 inhibitor; IL1F3; IL1RA; IL1RA_HUMAN; IL1RN (IL1F3); IL1RN; Interleukin 1 receptor antagonist; Interleukin-1 receptor antagonist protein; Intracellular IL 1 receptor antagonist type II; Intracellular interleukin 1 receptor antagonist (icIL 1ra); IRAP; MGC10430; MVCD4; Type II interleukin 1 receptor antagonist
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Expression Range	26-177aa
Protein Length	Full Length of Mature Protein
Mol. Weight	21.1kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure.
Subcellular Location	[Isoform 1]: Secreted.; [Isoform 2]: Cytoplasm.; [Isoform 3]: Cytoplasm.; [Isoform 4]: Cytoplasm.
Database References	HGNC: 6000 OMIM: 147679 KEGG: hsa:3557 STRING: 9606.ENSP00000259206 UniGene: Hs.81134
Associated Diseases	Microvascular complications of diabetes 4 (MVCD4); Interleukin 1 receptor antagonist deficiency (DIRA)
Tissue Specificity	The intracellular form of IL1RN is predominantly expressed in epithelial cells.

Gene Functions References

PDE4B-deficient mice displayed an increased circulating IL-1Ra, suggesting a protective role of PDE4B inactivation in vivo. PMID: 28383060
Interleukin 1 receptor antagonist*A2 might be a risk factor for progressive vitiligo. PMID: 29620037
IL1-Ra is an independent predictor for adverse outcomes in patients with documented coronary artery disease. PMID: 29395365
Carrying allele IL1RN*2 had a strong association with idiopathic recurrent spontaneous abortion (iRSA) in Mexican women; this polymorphism codifies for a low-function protein, which may allow for increased activity of IL-1 pro-inflammatory axis in iRSA. PMID: 29718011
there was no sufficient evidence to support the association between IL-1RN 86-bp VNTR polymorphism and ischemic stroke (Meta-Analysis) PMID: 30075593
Serum interleukin 1 receptor antagonist (IL1RA) and granzyme B (GZMB) levels were markedly increased in Crohn's disease (CD) patients, suggesting that these markers can serve as biomarkers to identify gut inflammation. PMID: 28972805
this study reflects the importance of the IL1RN*2/2 genotype and its possible association in the pathogenesis of RA by regulation in the IL-1Ra production. PMID: 29226727
Data show that the frequency of the IL-1 receptor antagonist (IL-1RN) 'T' allele of rs928940 was significantly lower in BC cases than in controls. PMID: 29047186
TNF-alpha -857 C/C variant might represent protective effect against recurrent pregnancy loss (RPL) and the -857 C/T variant might be a genetic risk factor for the occurrence of RPL. Invariant differences in the prevalence of -511 C/T and -31 C/T polymorphisms and IL-1RN VNTR between RPL patients. PMID: 29949333
IL-1ra concentrations were greater (p = 0.0018) in bone marrow aspirate samples (13,432 pg/mL) than in platelet-rich plasma (588 pg/mL). PMID: 26831858
Studied role of IL-1Ra VNTR variant in susceptibility of temporomandibular joint disorders (TMD), and found the variant is significantly associated with TMD. PMID: 28612927
Studied interleukin-1 receptor antagonist (IL-1Ra) and angiotensin-converting enzyme (ACE) I/D polymorphisms with regards to the susceptibility of patients to carpal tunnel syndrome. PMID: 28370589
we did not observe an association between IL-1Ra 86 bp VNTR polymorphism in intron 2 and RPL patients (p > 0.05). Conclusion IL-1Ra VNTR polymorphism may not be a genetic factor for RPL PMID: 28593919
The presence of the rs2234663 A2/A2 genotype in rheumatoid arthritis is associated with increased disease activity. PMID: 28342152
The results suggest that although the 1068 G>A polymorphism of the P2RX7 gene is associated with an increased beta-cell function and IL-1Ra release in type 2 diabetes patients, the glycemic control is not significantly affected by the presence of this SNP. PMID: 29425823
Studies used adult stem cells to engineer anatomically shaped, functional cartilage constructs capable of tunable and inducible expression of antiinflammatory molecules, specifically IL-1 receptor antagonist (IL-1Ra). PMID: 27432980
No significant associations with RHD were found for the IL1RN rs447713 and CTLA4 rs3087243 SNPs. PMID: 27400406
Reconstitution of ST2 (IL-1R4) specific for IL-33 activity; no suppression by IL-1Ra though a common chain IL-1R3 (IL-1RAcP) shared with IL-1 PMID: 27031441
The polymorphic expression of IL-1RN (rs419598) gene may be associated with a reduced susceptibility to GAgP and GCP in populations of European descent. PMID: 29023524
associations between the genetic variants and the LPS-induced IL-6, IL-8, IL-10, IL-1ra and TNF-alpha cytokine levels were not significant in the meta-analysis. This present study does not support a strong genetic effect of LPS-stimulated cytokine production; however, the potential for type II errors should be considered PMID: 23823136
IL1RA intron 2 VNTR seems to be a genetic marker for overall adiposity status in Malaysian subjects. PMID: 28293435
Increased IL-1Ra levels in women with polycystic ovary syndrome were largely explained by increasing adiposity. However, serum IL-1Ra concentrations predicted 2-h glucose levels independently of BMI suggesting that increased IL-1Ra may be associated with disturbed glucose metabolism. PMID: 27061312
demonstrated that IL-1RN VNTR polymorphism might increase the risk of H. pylori infection, especially in Asians PMID: 28384207
VNTR polymorphism associated with osteomyelitis development PMID: 28682145
Polymorphisms of Il1rn were not significantly associated with bipolar I disorder in Iranian patients. PMID: 28129679
Meta-analysis: Serum IL-1RA levels were positively associated with risk of cardiovascular disease. This association may at least partially reflect a response to triggers inducing subclinical inflammation, oxidative stress, and endothelial activation. PMID: 28428221
Our work highlights the convenience and efficiency of this novel pH-sensitive fluorescent probe and reveals the new biological activity of staurosporine as an agonist for GLUT4 translocation and as an effective insulin additive analogue. PMID: 27769857
African American women are at increased risk for early birth, particularly via the inflammatory pathway. Variants of the IL1RN gene, which encode the interleukin-1 receptor antagonist (IL-1Ra) protein, are implicated in early birth PMID: 28252571
This study reveled that the association of IL1RN haplotype containing RN2 with FIRES, and showed a possible association of IL1RN rs4251981 G > A. PMID: 27538648
We found that the mean mRNA levels of the proinflammatory cytokines IL-1beta, IL-6, TNF-alpha, their receptors, TNFR1, TNFR2, IL-1R1 and the antagonist IL-1RA were significantly increased in the lymphocytes of MDD patients compared with NC [normal control subjects].. PMID: 27138824
C/T genotype of IL-1Ra +2018 prognosticates more aggressive disease in RA PMID: 27105431
this study shows that IL-1Ra gene variants are associated with susceptibility to juvenile idiopathic arthritis in Iranian population PMID: 27717726
The A2 allele of the interleukin 1 receptor antagonist VNTR polymorphism could be a protective factor for pre-eclampsia susceptibility. PMID: 26555681
A2 allele and the combined IL-4 (low) -IL-1Ra (high) genotype might be genetic markers of susceptibility to frailty in Mexican elderly. PMID: 26646252
This study demonstrated that thr frequency of the IL-1Ra/C allele at position Mspa-I 11100 was decreased significantly and the IL-1Ra/T frequency was significantly increased in patients with Febrile Seizures. PMID: 26500244
Data indicate that levels of interleukin 1 receptor antagonist protein (IL-1-Ra) remain elevated for at least one year after storage at -80 degrees C. PMID: 26994310
study showed that, IL-1RN allele 2, periodontal disease characterized with clinical attachment loss, previous preterm/low birth weight outcome (PLBW) and age could be important risk factors for PLBW PMID: 26445016
Significant associations were found between Crohn's disease (CD) and minor NOD2 variants, as well as TLR4 299Gly, TNF-alpha G-308A, IL-6 G-174C and IL-1RN VNTR A2 variants, while ulcerative colitis (UC) was associated only with IL-1RN VNTR A2 variants. PMID: 26316104
Suggest that IL-1RN rs315952 polymorphism may not be associated with susceptibility to Tourette syndrome in Chinese Han population. PMID: 26097611
Serum IL1RA and IL2RA are predictors of event free survival in T-cell lymphoma. PMID: 26487586
IL-1Ra can be a useful tool in the diagnosis of hepatic inflammation. PMID: 26612588
This study shows a significant association between IL-1 RA allele distribution and febrile convulsions PMID: 26813462
IL-1 genotypes do not seem to be good predictors of peri-implantitis in the great majority of smoking patients PMID: 26449434
the lower expression of IL10 and the higher expression of IL1RA in Mo exposed to arthritic than to non-arthritic SF suggest that arthritic SF is mainly reducing the inflammatory responses in Mo. PMID: 26521731
Results indicate there is a lack of association between the IL1RN VNTR polymorphisms and tuberculosis risk. [Meta-Analysis] PMID: 26330006
The IL-4 rs79071878 polymorphism, was associated whereas the IL-1Ra rs2234663 polymorphism was not associated with Familial Mediterranean Fever risk in the Turkish population. PMID: 26861613
While both contributing to pathogen clearance, NLRP3 more than NLRC4 contributes to deleterious inflammatory responses in cystic fibrosis and correlates with defective NLRC4-dependent IL-1Ra production. PMID: 26972847
These data suggest that M. leprae upregulates IL-1Ra by a TOLLIP-dependent mechanism; inhibition of TOLLIP may decrease an individual's susceptibility to leprosy and offer a novel therapeutic target for IL-1-dependent diseases. PMID: 26610735
This study emphasizes a positive association between IL1-Ra (VNTR) polymorphism and DM among Saudi children. This may suggest that (A2) allele may play important role in disease susceptibility. PMID: 26502861
IL1-RN VNTR A1A3 genotype is associated with higher risk of RA. Among the cases, males who carry this genotype were more exposed to RA and had less erosive forms. PMID: 26003199

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.