Recombinant Human Interleukin-1 Family Member 10 (IL1F10) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09857P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Interleukin-1 Family Member 10 (IL1F10) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09857P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Interleukin-1 Family Member 10 (IL1F10) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q8WWZ1 |
Target Symbol | IL1F10 |
Synonyms | family of interleukin 1-theta; FIL1 theta; FIL1T; FKSG75; IL 38; IL-1 theta; IL-1F10 (canonical form IL-1F10a); IL-1F10; IL-1HY2; IL1 theta; IL1F10; IL1FA_HUMAN; IL1HY2; Interleukin 1 family member 10 (theta); Interleukin 1 receptor antagonist FKSG75; Interleukin 1 receptor antagonist homolog 2; Interleukin 1 receptor antagonist like FIL1 theta; Interleukin-1 family member 10; Interleukin-1 HY2; Interleukin-1 theta; interleukin-38 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW |
Expression Range | 1-152aa |
Protein Length | Full Length |
Mol. Weight | 32.9kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2. |
Subcellular Location | Cytoplasm. Secreted. |
Protein Families | IL-1 family |
Database References | |
Tissue Specificity | Expressed in fetal skin, spleen and tonsil. Expressed mostly in the basal epithelia of skin and in proliferating B-cells of the tonsil. |
Gene Functions References
- The serum level of IL-38 in the children in the acute phase of Kawasaki disease was significantly lower than that in the healthy control group PMID: 30022755
- IL-38 may play an important role in acute and/or chronic inflammation in anticancer drug-induced lung injury and acute exacerbation of idiopathic pulmonary fibrosis. PMID: 28942884
- IL-38 may exert its anti-inflammatory effects by decreasing the production of proinflammatory cytokines by macrophages and synovial fibroblasts. PMID: 28288964
- this clinical study demonstrates the elevation of anti-inflammatory cytokine IL-38 and the decrement of CD4+CD25highFoxP3+ and CD4+CD25highCD127- Treg in childhood asthma. The negative correlation of IL-38 and Treg lymphocytes may imply a negative feedback of the two anti-inflammatory factors in asthma. PMID: 27438823
- this study shows that in vivo expression of human IL-38 in mice has hepatoprotective effects against Con A-induced liver injury by inhibition of inflammatory cytokine production PMID: 27723569
- Higher serum IL-38 levels before treatment indicate a greater probability of viral response to telbivudine treatment in chronic hepatitis B. PMID: 27182162
- results indicate that circulating IL-38 is a potentially novel biomarker for patients with ST-segment elevation myocardial infarction PMID: 26819499
- Data suggest that IL-38 may be protective in SLE. A strong association between IL-38 and SLE severity suggests that IL-38 expression is driven by processes linked to SLE pathogenesis. PMID: 26314375
- rs6759676, closest gene locus IL1F10 is associated with increased circulating levels of IL-1 receptor antagonist, a protective factor in development of insulin resistance. PMID: 24969107
- The IL1A locus was strongly associated with alkylosing spondyloarthritis phenotype, whereas IL1F10 was associated with non-alkylosing spondyloarthritis. PMID: 22312160
- These data provide evidence that IL-38 binds to the IL-36R, as does IL-36Ra.[IL-38, IL-36R] PMID: 22315422