Recombinant Human Interleukin-1 Alpha (IL1A) Protein (His)

Beta LifeScience SKU/CAT #: BLC-07887P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Interleukin-1 Alpha (IL1A) Protein (His)

Beta LifeScience SKU/CAT #: BLC-07887P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Interleukin-1 Alpha (IL1A) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P01583
Target Symbol IL1A
Species Homo sapiens (Human)
Expression System Yeast
Tag N-6His
Target Protein Sequence SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Expression Range 113-271aa
Protein Length Full Length of Mature Protein
Mol. Weight 20.0 kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Subcellular Location Cytoplasm. Secreted.
Protein Families IL-1 family
Database References

Gene Functions References

  1. Based on the available data, C/T genotype of the rs1800587 polymorphism within IL1A gene may be associated with an increased Graves' disease risk. PMID: 29879187
  2. IL-1 was positively related with increased BMI overweight and obesity PMID: 30070872
  3. IL-1alpha is detectable in the majority of patients with infrarenal abdominal aortic aneurysms. PMID: 29456054
  4. Meta-analysis suggests that the IL-1B rs16944 polymorphism is a susceptibility risk factor for febrile seizures in Caucasian and Asian populations. The IL-1B rs1143627, IL-1B rs1143634, and IL-1A rs1800587 polymorphisms are not associated with febrile seizure risk. PMID: 29808330
  5. The IL-1b+3954 C/T polymorphism significantly increases RAS risk. In addition, the IL-10-1082 G/A polymorphism provided protective effects for RAS in the Asian population PMID: 29641282
  6. The single nucleotide polymorphism (SNP) of IL-1beta gene (rs3917356G>A) increased the risk of HCC in the recessive model (p<0.001, OR=2.58, 95% CI=1.53-4.33), whereas other SNPs in IL-1alpha and IL-1RA showed no significant association between Hepatocellular carcinoma patients and controls. PMID: 29802240
  7. our findings proposed an association between IL1A 4-bp ins/del polymorphism and risk of prostate cancer PMID: 29023981
  8. effect of IL-22 on Intestinal Epithelial Cells responses may not be in inducing CXCL8 by itself, but in enhancing TNF-alpha- and IL-1-induced CXCL8 secretion to augment the contribution of IECs to local inflammatory responses. PMID: 28656529
  9. Our pilot study demonstrated a correlation between the individual genetic inflammatory profile and the efficacy of the platelet rich plasma treatment in males PMID: 29228441
  10. the present study was intended to determine whether single-nucleotide polymorphisms (SNPs) in the IL-1 gene cluster are also associated with periodontal disease in a Linkage disequilibrium analysis PMID: 29577711
  11. No significant difference was seen in mRNA levels among different promoter genotype for IL1A in SCA3 patients vs. controls, except a previously reported higher level in those with the IL1A*T allele. These patients also showed an earlier age of onset than those homozygous for IL1A*C. PMID: 27246313
  12. Obesity was associated with higher expression of NILCO molecules (Notch-IL1-leptin) in type II endometrial cancer. PMID: 28659656
  13. This meta-analysis with 2,174 patients with chronic periodontitis and 1, 756 controls evidenced the -889 C/T polymorphism is associated to risk of development of chronic periodontitis with no significant value to heterogeneity to allelic evaluation PMID: 27918732
  14. through IL-1alpha production, airway epithelial cells induce a pro-inflammatory lung fibroblast phenotype that is further enhanced with cigarette smoke extract exposure in COPD, suggesting an aberrant epithelial-fibroblast interaction in COPD PMID: 27418555
  15. our study has described the association between rs3783550 (IL-1A), rs3783546 (IL-1A) and rs2853550 (IL-1B) and AS risk and between a new haplotype, "TCG", of rs3783550, rs3783546 and rs2853550 and AS in Chinese Han population. PMID: 28423679
  16. Unicystic Ameloblastoma patients with high IL-1alpha expression in the lesion responded better to marsupialization than those in whom the expression of the protein was low, and therefore show a greater reduction of the cystic space after marsupialization. PMID: 29419674
  17. In conclusion, the analyzed IL1A -889 C>T, IL1B +3954 C>T, and IL6 -174 G>C polymorphisms may be associated with the occurrence and development of human cytomegalovirus infection among studied patients. PMID: 28151075
  18. Lipid apheresis suppresses the expression of IL-1alpha, IL-6 and TNF-alpha mRNA in patients with dyslipidaemias. PMID: 29096839
  19. results suggest a role for prostatic expression of TGF-B, IL-1a, TGFBRI and TGFBRII as prognostic markers for prostate cancer. The rational combination of novel agents directed toward the inactivation of TGF-B, IL-1a, TGFBRI and TGFBRII could disrupt complementary tumor cell proliferation pathways. PMID: 27527810
  20. There were no significant differences in GE area of infertile and fertile women. C-C motif chemokine 11 (P=0.048), TGFalpha (P=0.049), IFNgamma (P=0.033) and interleukin-1 alpha (P=0.047) were significantly elevated in uterine lavage from infertile women <35years compared to fertile but not in women 35years PMID: 27525354
  21. The authors' findings suggest that IL-1a rs3783553 polymorphism may modulate the risk of squamous cell carcinoma of the oropharynx recurrence in patients, particularly for patients with HPV16-positive tumors. PMID: 27121322
  22. IL-1alpha released from necrotic corneal epithelial cells may trigger inflammatory responses at the ocular surface, including cytokine production and barrier disruption. PMID: 28725984
  23. Based on current meta-analysis, we indicated that there is lack of association between the three SNPs of IL-1 and primary open-angle glaucoma. PMID: 29179746
  24. results showed that IL-1A -889C/T (rs1800587) was associated with systemic sclerosis susceptibility in the Chinese population PMID: 27098064
  25. Reconstitution of ST2 (IL-1R4) specific for IL-33 activity; no suppression by IL-1Ra though a common chain IL-1R3 (IL-1RAcP) shared with IL-1. PMID: 27031441
  26. A SNP in IL1A were associated with keratoconus in Chinese Han patients PMID: 26200829
  27. these findings highlight the interaction between IL-6 and IL-1alpha to generate an inflammatory microenvironment in driving (PSMA,PSA) prostate clones PMID: 27451139
  28. MSCs primed with IL-1alpha or IL-1beta showed increased secretion of G-CSF, which was blocked by IL-1Ra. PMID: 28412968
  29. rs3783553 ins/ins genotype may increase the susceptibility to ischemic stroke, possibly by interrupting the binding site of miR-122 and miR-378 PMID: 29145255
  30. The abnormalities in hormonal/biochemical parameters detected in Turkish polycystic ovary syndrome patients may be related with IL-6 gene polymorphism rather than IL-1A. PMID: 28019133
  31. Major D allele of IL-1A (I/D) gene polymorphism is associated with NAFLD in the Egyptian population PMID: 28627263
  32. Interleukin-1alpha induces release of interleukin-8 by human bronchial epithelial cells PMID: 28078769
  33. the results indicate prominent antagonistic effects of IL-1alpha on TGF-beta regulated interferon signaling, as well as on a wide variety of other genes and pathways in fibroblasts. PMID: 26629874
  34. IL1A polymorphism rs1800587 is associated with chronic pain in patients with sickle cell disease. PMID: 27883292
  35. Data indicate that interleukin 1alpha (IL-1alpha) propiece can activate NF-kappa B (NFkappaB) and Sp1 transcription factor (SP1). PMID: 28152513
  36. cytokines of the IL-1 family play an important role in homeostatic as well as "emergency" hematopoiesis and are involved in the pathogenesis of several myeloid and lymphoid hematological malignancies. PMID: 28483765
  37. These results suggest that IL-1alpha enhances the translocation of TRPA1 to the plasma membrane via the activation of Erk in A549. PMID: 28629997
  38. Single Nucleotide Variants of Candidate Genes in Aggrecan Metabolic Pathway Are Associated with Lumbar Disc Degeneration and Modic Changes PMID: 28081267
  39. Polymorphisms of Il1a were not significantly associated with bipolar I disorder in Iranian patients. PMID: 28129679
  40. This meta-analysis suggested that the IL-1alpha (+889C/T) polymorphism is significantly associated with risk of Intervertebral Disc Degeneration, especially in Caucasian populations. PMID: 27253397
  41. we show that IL-1 induces robust p38a activation both in the nucleus and in the cytoplasm/membrane.Following stimulation, p38a activity returns to a basal level in absence of receptor degradation. While nuclear pulse is controlled by MKP1 through a negative feedback to pp38, its basal activity is controlled by both TAB1 and MKP1 through a positive feedback loop. PMID: 27314954
  42. Key aspects of IL-1alpha biology and regulation, especially its emerging importance in the initiation and maintenance of inflammation that underlie the pathology of many human diseases, are reviewed. Review. PMID: 27434011
  43. This study demonstrates that the rs3783553 polymorphism may be involved in susceptibility to endometrial cancer. The II genotype seems to be a protective factor for endometrial cancer in Chinese Han women. PMID: 27136893
  44. Circulating Il1a levels were not altered in nonalcoholic fatty liver disease. PMID: 27493109
  45. The IL-1alpha rs1800587 polymorphism demonstrated a significant association with the childhood type 1 diabetes mellitus risk. PMID: 27706611
  46. The percentage of the -889 promotor SNP was similar but not overlapping in all the groups: periodontal disease only (40.8%), PD plus rheumatoid arthritis (50.2%), and PD plus NIDDM (46%). PMID: 27655512
  47. this study shows that IL-1a gene variants are not associated with susceptibility to juvenile idiopathic arthritis in Iranian population PMID: 27717726
  48. IL1 and IL6 are important components of the tumor microenvironment, displaying multiple functions. These cytokines take part at all stages of oncogenesis: from initiation to tumor, invasion, and metastasis of already established malignant and mutant epithelial cells. [Review] PMID: 27260388
  49. IL-1genotype has no effect on Antibiotic Resistance on Helicobacter pylori Eradication. PMID: 27221874
  50. Genetic polymorphisms in the IL1A, IL1B, IL2 and IL6 genes are not genetic modulators of depression in a cohort of Polish subjects. PMID: 26934083

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed