Recombinant Human Interleukin-1 alpha (IL1A), Active, GMP

Beta LifeScience SKU/CAT #: BLC-05415P
Greater than 98% as determined by SDS-PAGE.
Greater than 98% as determined by SDS-PAGE.

Recombinant Human Interleukin-1 alpha (IL1A), Active, GMP

Beta LifeScience SKU/CAT #: BLC-05415P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Interleukin-1 alpha (IL1A), Active, GMP is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 98% as determined by SDS-PAGE and HPLC.
Endotoxin Less than 0.01 EU/μg of rHuIL-1α GMP as determined by LAL method.
Activity Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 1.0 pg/ml, corresponding to a specific activity of > 1.0 × 109 IU/mg.
Uniprotkb P01583
Target Symbol IL1A
Synonyms BAF; FAF; Hematopoietin 1; Hematopoietin-1; IL 1 alpha; IL 1A; IL-1 alpha; Il-1a; IL1 ALPHA; IL1; IL1A; IL1A_HUMAN; IL1F1; Interleukin 1 alpha; Interleukin-1 alpha; Interleukin1 alpha; LAF; LEM; Preinterleukin 1 alpha; Pro interleukin 1 alpha
Species Homo sapiens (Human)
Expression System E.Coli
Tag Tag-Free
Complete Sequence SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Expression Range 113-271aa
Protein Length Full Length of Mature Protein
Mol. Weight 18 kDa
Research Area Immunology
Form Lyophilized powder
Buffer Lyophilized from a 0.2 µm filtered concentrated solution in 25 mM Tris-HCl, pH8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Subcellular Location Cytoplasm. Secreted.
Protein Families IL-1 family
Database References

HGNC: 5991

OMIM: 147760

KEGG: hsa:3552

STRING: 9606.ENSP00000263339

UniGene: PMID: 29879187

  • IL-1 was positively related with increased BMI overweight and obesity PMID: 30070872
  • IL-1alpha is detectable in the majority of patients with infrarenal abdominal aortic aneurysms. PMID: 29456054
  • Meta-analysis suggests that the IL-1B rs16944 polymorphism is a susceptibility risk factor for febrile seizures in Caucasian and Asian populations. The IL-1B rs1143627, IL-1B rs1143634, and IL-1A rs1800587 polymorphisms are not associated with febrile seizure risk. PMID: 29808330
  • The IL-1b+3954 C/T polymorphism significantly increases RAS risk. In addition, the IL-10-1082 G/A polymorphism provided protective effects for RAS in the Asian population PMID: 29641282
  • The single nucleotide polymorphism (SNP) of IL-1beta gene (rs3917356G>A) increased the risk of HCC in the recessive model (p<0.001, OR=2.58, 95% CI=1.53-4.33), whereas other SNPs in IL-1alpha and IL-1RA showed no significant association between Hepatocellular carcinoma patients and controls. PMID: 29802240
  • our findings proposed an association between IL1A 4-bp ins/del polymorphism and risk of prostate cancer PMID: 29023981
  • effect of IL-22 on Intestinal Epithelial Cells responses may not be in inducing CXCL8 by itself, but in enhancing TNF-alpha- and IL-1-induced CXCL8 secretion to augment the contribution of IECs to local inflammatory responses. PMID: 28656529
  • Our pilot study demonstrated a correlation between the individual genetic inflammatory profile and the efficacy of the platelet rich plasma treatment in males PMID: 29228441
  • the present study was intended to determine whether single-nucleotide polymorphisms (SNPs) in the IL-1 gene cluster are also associated with periodontal disease in a Linkage disequilibrium analysis PMID: 29577711
  • No significant difference was seen in mRNA levels among different promoter genotype for IL1A in SCA3 patients vs. controls, except a previously reported higher level in those with the IL1A*T allele. These patients also showed an earlier age of onset than those homozygous for IL1A*C. PMID: 27246313
  • Obesity was associated with higher expression of NILCO molecules (Notch-IL1-leptin) in type II endometrial cancer. PMID: 28659656
  • This meta-analysis with 2,174 patients with chronic periodontitis and 1, 756 controls evidenced the -889 C/T polymorphism is associated to risk of development of chronic periodontitis with no significant value to heterogeneity to allelic evaluation PMID: 27918732
  • through IL-1alpha production, airway epithelial cells induce a pro-inflammatory lung fibroblast phenotype that is further enhanced with cigarette smoke extract exposure in COPD, suggesting an aberrant epithelial-fibroblast interaction in COPD PMID: 27418555
  • our study has described the association between rs3783550 (IL-1A), rs3783546 (IL-1A) and rs2853550 (IL-1B) and AS risk and between a new haplotype, "TCG", of rs3783550, rs3783546 and rs2853550 and AS in Chinese Han population. PMID: 28423679
  • Unicystic Ameloblastoma patients with high IL-1alpha expression in the lesion responded better to marsupialization than those in whom the expression of the protein was low, and therefore show a greater reduction of the cystic space after marsupialization. PMID: 29419674
  • In conclusion, the analyzed IL1A -889 C>T, IL1B +3954 C>T, and IL6 -174 G>C polymorphisms may be associated with the occurrence and development of human cytomegalovirus infection among studied patients. PMID: 28151075
  • Lipid apheresis suppresses the expression of IL-1alpha, IL-6 and TNF-alpha mRNA in patients with dyslipidaemias. PMID: 29096839
  • results suggest a role for prostatic expression of TGF-B, IL-1a, TGFBRI and TGFBRII as prognostic markers for prostate cancer. The rational combination of novel agents directed toward the inactivation of TGF-B, IL-1a, TGFBRI and TGFBRII could disrupt complementary tumor cell proliferation pathways. PMID: 27527810
  • There were no significant differences in GE area of infertile and fertile women. C-C motif chemokine 11 (P=0.048), TGFalpha (P=0.049), IFNgamma (P=0.033) and interleukin-1 alpha (P=0.047) were significantly elevated in uterine lavage from infertile women <35years compared to fertile but not in women 35years PMID: 27525354
  • The authors' findings suggest that IL-1a rs3783553 polymorphism may modulate the risk of squamous cell carcinoma of the oropharynx recurrence in patients, particularly for patients with HPV16-positive tumors. PMID: 27121322
  • IL-1alpha released from necrotic corneal epithelial cells may trigger inflammatory responses at the ocular surface, including cytokine production and barrier disruption. PMID: 28725984
  • Based on current meta-analysis, we indicated that there is lack of association between the three SNPs of IL-1 and primary open-angle glaucoma. PMID: 29179746
  • results showed that IL-1A -889C/T (rs1800587) was associated with systemic sclerosis susceptibility in the Chinese population PMID: 27098064
  • Reconstitution of ST2 (IL-1R4) specific for IL-33 activity; no suppression by IL-1Ra though a common chain IL-1R3 (IL-1RAcP) shared with IL-1. PMID: 27031441
  • A SNP in IL1A were associated with keratoconus in Chinese Han patients PMID: 26200829
  • these findings highlight the interaction between IL-6 and IL-1alpha to generate an inflammatory microenvironment in driving (PSMA,PSA) prostate clones PMID: 27451139
  • MSCs primed with IL-1alpha or IL-1beta showed increased secretion of G-CSF, which was blocked by IL-1Ra. PMID: 28412968
  • rs3783553 ins/ins genotype may increase the susceptibility to ischemic stroke, possibly by interrupting the binding site of miR-122 and miR-378 PMID: 29145255
  • The abnormalities in hormonal/biochemical parameters detected in Turkish polycystic ovary syndrome patients may be related with IL-6 gene polymorphism rather than IL-1A. PMID: 28019133
  • Major D allele of IL-1A (I/D) gene polymorphism is associated with NAFLD in the Egyptian population PMID: 28627263
  • Interleukin-1alpha induces release of interleukin-8 by human bronchial epithelial cells PMID: 28078769
  • the results indicate prominent antagonistic effects of IL-1alpha on TGF-beta regulated interferon signaling, as well as on a wide variety of other genes and pathways in fibroblasts. PMID: 26629874
  • IL1A polymorphism rs1800587 is associated with chronic pain in patients with sickle cell disease. PMID: 27883292
  • Data indicate that interleukin 1alpha (IL-1alpha) propiece can activate NF-kappa B (NFkappaB) and Sp1 transcription factor (SP1). PMID: 28152513
  • cytokines of the IL-1 family play an important role in homeostatic as well as "emergency" hematopoiesis and are involved in the pathogenesis of several myeloid and lymphoid hematological malignancies. PMID: 28483765
  • These results suggest that IL-1alpha enhances the translocation of TRPA1 to the plasma membrane via the activation of Erk in A549. PMID: 28629997
  • Single Nucleotide Variants of Candidate Genes in Aggrecan Metabolic Pathway Are Associated with Lumbar Disc Degeneration and Modic Changes PMID: 28081267
  • Polymorphisms of Il1a were not significantly associated with bipolar I disorder in Iranian patients. PMID: 28129679
  • This meta-analysis suggested that the IL-1alpha (+889C/T) polymorphism is significantly associated with risk of Intervertebral Disc Degeneration, especially in Caucasian populations. PMID: 27253397
  • we show that IL-1 induces robust p38a activation both in the nucleus and in the cytoplasm/membrane.Following stimulation, p38a activity returns to a basal level in absence of receptor degradation. While nuclear pulse is controlled by MKP1 through a negative feedback to pp38, its basal activity is controlled by both TAB1 and MKP1 through a positive feedback loop. PMID: 27314954
  • Key aspects of IL-1alpha biology and regulation, especially its emerging importance in the initiation and maintenance of inflammation that underlie the pathology of many human diseases, are reviewed. Review. PMID: 27434011
  • This study demonstrates that the rs3783553 polymorphism may be involved in susceptibility to endometrial cancer. The II genotype seems to be a protective factor for endometrial cancer in Chinese Han women. PMID: 27136893
  • Circulating Il1a levels were not altered in nonalcoholic fatty liver disease. PMID: 27493109
  • The IL-1alpha rs1800587 polymorphism demonstrated a significant association with the childhood type 1 diabetes mellitus risk. PMID: 27706611
  • The percentage of the -889 promotor SNP was similar but not overlapping in all the groups: periodontal disease only (40.8%), PD plus rheumatoid arthritis (50.2%), and PD plus NIDDM (46%). PMID: 27655512
  • this study shows that IL-1a gene variants are not associated with susceptibility to juvenile idiopathic arthritis in Iranian population PMID: 27717726
  • IL1 and IL6 are important components of the tumor microenvironment, displaying multiple functions. These cytokines take part at all stages of oncogenesis: from initiation to tumor, invasion, and metastasis of already established malignant and mutant epithelial cells. [Review] PMID: 27260388
  • IL-1genotype has no effect on Antibiotic Resistance on Helicobacter pylori Eradication. PMID: 27221874
  • Genetic polymorphisms in the IL1A, IL1B, IL2 and IL6 genes are not genetic modulators of depression in a cohort of Polish subjects. PMID: 26934083

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Sale
    SDS-PAGE analysis of Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein, CAT# BLT-08014P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein
    • Molecule: CEBPB;
    • Species: Mouse;
    • Expression system: E.coli;
    • Tag: N-His-GST;
    • Sequence: 1-296aa;
    CAT#: BLT-08014P

    Save $50
    Sale
    SDS-PAGE analysis of Human BAX (Apoptosis Regulator Bax) - Recombinant Protein, CAT# BLT-07419P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human BAX (Apoptosis Regulator Bax) - Recombinant Protein
    • Molecule: BAX;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-171aa;
    CAT#: BLT-07419P

    Save $50
    Recently viewed