Recombinant Human Interferon Lambda Receptor 1 (IFNLR1) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-01178P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Interferon Lambda Receptor 1 (IFNLR1) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-01178P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Interferon Lambda Receptor 1 (IFNLR1) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q8IU57
Target Symbol IFNLR1
Synonyms (IFN-lambda receptor 1)(IFN-lambda-R1)(Cytokine receptor class-II member 12)(Cytokine receptor family 2 member 12)(CRF2-12)(Interleukin-28 receptor subunit alpha)(IL-28 receptor subunit alpha)(IL-28R-alpha)(IL-28RA)(Likely interleukin or cytokine receptor 2)(LICR2)
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA
Expression Range 21-228aa
Protein Length Partial
Mol. Weight 36.6 kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Determines the cell type specificity of the lambda interferon action. Shows a more restricted pattern of expression in the epithelial tissues thereby limiting responses to lambda interferons primarily to epithelial cells of the respiratory, gastrointestinal, and reproductive tracts. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium.
Subcellular Location Membrane; Single-pass type I membrane protein.
Protein Families Type II cytokine receptor family
Database References
Tissue Specificity Widely expressed.

Gene Functions References

  1. IFN-lambda4 suppressed HIV infection of macrophages. This IFN-lambda4-mediated HIV inhibition was compromised by the antibodies against IFN-lambda receptor complex, IFN-lambdaR1/IL-10R2. PMID: 30247785
  2. Significant associations were observed for 4 variants in IFNAR2, IFNLR1 with hepatitis B virus infection, and IFNLR1-rs4649203 was associated with hepatitis B recovery. Moreover, the authors demonstrated the clear relevance of 5 polymorphisms in IFNA1, IFNA2, IFNL4 with hepatocellular carcinoma. PMID: 29080269
  3. In this structure, the receptor peptide forms an 85-A-long extended chain, in which both the previously identified box1 and box2 regions bind simultaneously to the FERM and SH2-like domains of JAK1. PMID: 27725180
  4. Results show that IFNLR1 box1 and box2 motifs are required for stable complex formation with JAK1 and the crystal structure of JAK1 reveals IFNLR1 box1 binding site in the FERM domain. Also, structure-based mutagenesis reveals IFNLR1 PxxLxF motif that is essential for binding. Structure of JAK1 with IL10RA box1 indicates conservation among class II receptors. PMID: 27133025
  5. Selective expression of IFNlambdaR1 was considered to be a plus point towards the targeted anti-viral activity of IFNlambdas but artificial control on its expression will surely make IFNlambdas a better drug with enhanced activity. PMID: 27166550
  6. expression of IL-28RA mRNA may be correlated with the pathogenesis of systemic lupus erythematosus PMID: 25911176
  7. Polymorphism within the IL-28R1, but not in IL-28B, is associated with benign prostatic hyperplasia and lower urinary tract symptoms in Chinese. PMID: 26400298
  8. Results show that the distribution of IL10RB and IL28RA genotypes among the Hepatitis C virus-infected and control groups did not differ significantly. PMID: 24144988
  9. This study is the first to show the activation of a type III interferon response in low-risk human papillomavirus positive cervical cells and suggests that the lack of this response may be related to lesion progression. PMID: 24510368
  10. IL28RA polymorphism (rs10903035) seems to be implicated in the glucose homeostasis because AA genotype increases the likelihood of IR, but this association was different depending on hepatic fibrosis and HCV genotype. PMID: 24438680
  11. Epigenetic reprogramming of IFNLR1-mediated response potentiates antiviral activity and suppresses tumor growth. PMID: 24409098
  12. IFN-lambda receptor 1 expression is induced in chronic hepatitis C and correlates with the IFN-lambda3 genotype and with nonresponsiveness to IFN-alpha therapies. PMID: 24752298
  13. The rs12980275 AG/GG genotype and rs10903035 G allele remained independently associated with early pegylated interferon and ribavirin failure of hepatitis C in hepatitis C/HIV coinfected patients. PMID: 23565619
  14. Plasmacytoid dendritic cells are major producers of IFN-lambda2 (a type III interferon) in response to viral stimulation and also express functional receptors for this cytokine. PMID: 22891284
  15. No consistent association is found between IL28RA and multiple sclerosis in a Basque-Spanish population. PMID: 22386267
  16. two SNPs in IL28RA are correlated with susceptibility to HCV infection and spontaneous viral clearance, which implicates a primary role of IL28RA in the outcomes of HCV infection PMID: 21742059
  17. IFN-lambdaR1 consists of two distinct domains having fibronectin type III topology. PMID: 20934432
  18. Although the IFN-lambda1(Bac)-IFN-lambda1R1 and IFN-lambda1(Ins)-IFN-lambda1R1 complexes differed only in the nature of the expression system used for the ligand, their crystallization conditions and crystal forms were quite different PMID: 20057073
  19. study supports that IFN-lambdas do not influence every type of cell and that membrane-associated variant IFN-lambda R1 expression is not sufficient to ensure cellular sensitivity toward these cytokines. PMID: 19798076
  20. IL-28 and IL-29 interact with a heterodimeric class II cytokine receptor that consisted of IL-10 receptor beta (IL-10Rbeta) and an orphan class II receptor chain, designated IL-28Ralpha. PMID: 12469119
  21. distinct receptor complex that is utilized by all three IFN-lambda proteins for signaling and is composed of two subunits, a receptor designated CRF2-12 (also designated as IFN-lambdaR1) and a second subunit, CRF2-4 (also known as IL-10R2) PMID: 12483210
  22. interleukin (IL)-28 receptor tyrosine residues have roles in antiviral and antiproliferative activity of IL-29/interferon-lambda 1 PMID: 15166220
  23. Results suggested that the g.32349 G>A polymorphism of IL-28RA might be associated with susceptibility to allergic rhinitis. PMID: 16819289

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed