Recombinant Human Interferon Kappa (IFNK) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00164P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Interferon Kappa (IFNK) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00164P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Interferon Kappa (IFNK) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Activity | Not tested. |
Uniprotkb | Q9P0W0 |
Target Symbol | IFNK |
Synonyms | (IFN-kappa) |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | LDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK |
Expression Range | 28-207aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 29.6 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May play a role in the regulation of immune cell function. Cytokine that imparts cellular protection against viral infection in a species-specific manner. Activates the interferon-stimulated response element signaling pathway. It is able to directly modulate cytokine release from monocytes and dendritic cells. Binds heparin. |
Subcellular Location | Secreted. |
Protein Families | Alpha/beta interferon family |
Database References | |
Tissue Specificity | Expressed in keratinocytes, monocytes and in resting dendritic cells. |
Gene Functions References
- investigation of common variable immunodeficiency (CVID) from 2 German families; report on the occurrence of a common and one novel truncating IFNK mutation in cases with CVID; the frequency distribution of c.30_31insTGTT in cases and controls as well as the observed segregation patterns in CVID families exclude IFNK mutations as major risk factor in CVID PMID: 28324805
- These results suggest that high-risk human papillomavirus 31 target interferon kappa to prevent Sp100 expression and identify Sp100 as an interferon-stimulated gene with anti-human papillomavirus activity. PMID: 26491169
- This study demonstrates that E2 proteins of high risk human papillomavirus reduce STING and IFN-kappa transcription. PMID: 24614210
- The viral E6 and E7 oncogenes are sufficient for interferon-kappa repression, with E6 being mainly responsible. PMID: 21849431
- IFN-kappa is down-regulated in cervical keratinocytes harboring HPV, which may be a contributing factor in the progression of a cervical lesion PMID: 20479716
- Studied IFNK single nucleotide polymorphisms in 3982 Systemic lupus erythematosus cases and 4275 controls. PMID: 20706608
- IFN-kappa is able to directly modulate cytokine release from monocytes and dendritic cells, inhibit inducible IL-12 release from monocytes, and bind strongly to heparin. PMID: 12391192
- This is the first report showing an epigenetic silencing of type I IFN after HPV16 oncogene expression PMID: 19887612