Recombinant Human Interferon-Induced Guanylate-Binding Protein 2 (GBP2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01125P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Interferon-Induced Guanylate-Binding Protein 2 (GBP2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01125P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Interferon-Induced Guanylate-Binding Protein 2 (GBP2) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P32456 |
Target Symbol | GBP2 |
Synonyms | (GTP-binding protein 2)(GBP-2)(HuGBP-2)(Guanine nucleotide-binding protein 2)(Interferon-induced guanylate-binding protein 2) |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | GLGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQLKEEELNPD |
Expression Range | 100-259aa |
Protein Length | Partial |
Mol. Weight | 22.4 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Hydrolyzes GTP to GMP in 2 consecutive cleavage reactions, but the major reaction product is GDP. Exhibits antiviral activity against influenza virus. Promotes oxidative killing and delivers antimicrobial peptides to autophagolysosomes, providing broad host protection against different pathogen classes. |
Subcellular Location | Cytoplasm. Cytoplasm, perinuclear region. Golgi apparatus membrane. Membrane; Lipid-anchor. |
Protein Families | TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, GB1 subfamily |
Database References | HGNC: 4183 OMIM: 600412 KEGG: hsa:2634 STRING: 9606.ENSP00000359497 UniGene: PMID: 29072687 |