Recombinant Human Interferon Alpha-Inducible Protein 6 (IFI6) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-03654P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Interferon Alpha-Inducible Protein 6 (IFI6) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-03654P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Interferon Alpha-Inducible Protein 6 (IFI6) Protein (His-B2M) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P09912 |
| Target Symbol | IFI6 |
| Synonyms | Ifi-6-16; IFI6; IFI6_HUMAN; Interferon alpha-inducible protein 6; Interferon-induced protein 6-16 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-B2M |
| Target Protein Sequence | GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE |
| Expression Range | 24-130aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 24.4kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis. However, it has also been shown to have a pro-apoptotic activity. Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells. |
| Subcellular Location | Mitochondrion inner membrane; Multi-pass membrane protein. |
| Protein Families | IFI6/IFI27 family |
| Database References | HGNC: 4054 OMIM: 147572 KEGG: hsa:2537 UniGene: PMID: 29899394 |
