Recombinant Human Interferon Alpha-2 (IFNA2), Active
Beta LifeScience
SKU/CAT #: BLC-06062P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Interferon Alpha-2 (IFNA2), Active
Beta LifeScience
SKU/CAT #: BLC-06062P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Interferon Alpha-2 (IFNA2), Active is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | Measured in antiviral assay using A549 human lung cancer cells infected with vesicular stomatitisvirus (VSV) The ED50 for this effect is 5 ng/mL. |
| Uniprotkb | P01563 |
| Target Symbol | IFNA2 |
| Synonyms | Alpha 2a interferon ; IFN alpha 2b; IFN-alpha-2; IFNA; Ifna2; IFNA2_HUMAN; INFA2; Interferon alpha 2; Interferon alpha A; Interferon alpha-2; Interferon alpha-A; LeIF A; LeIFA |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Complete Sequence | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Expression Range | 24-188aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 19.4 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
| Target Function | Produced by macrophages, IFN-alpha have antiviral activities. |
| Subcellular Location | Secreted. |
| Protein Families | Alpha/beta interferon family |
| Database References |
HGNC: 5423 OMIM: 147562 KEGG: hsa:3440 STRING: 9606.ENSP00000369554 UniGene: PMID: 28958921 |
