Recombinant Human Inter-Alpha-Trypsin Inhibitor Heavy Chain H4 (ITIH4) Protein (His)

Name: Recombinant Human Inter-Alpha-Trypsin Inhibitor Heavy Chain H4 (ITIH4) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04195P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) ITIH4.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Inter-Alpha-Trypsin Inhibitor Heavy Chain H4 (ITIH4) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q14624
Target Symbol	ITIH4
Synonyms	35 kDa inter-alpha-trypsin inhibitor heavy chain H4; gp120; H4P; IHRP; Inter-alpha-inhibitor heavy chain 4; Inter-alpha-trypsin inhibitor family heavy chain-related protein; Inter-alpha-trypsin inhibitor heavy chain H4; inter-alpha-trypsin inhibitor, heavy chain-like, 1; ITI heavy chain H4; ITI-HC4; ITIH4; ITIH4_HUMAN; ITIHL1; OTTHUMP00000197120; OTTHUMP00000197121; OTTHUMP00000213834; OTTHUMP00000213869; PK-120; PK120; Plasma kallikrein sensitive glycoprotein 120; PRO1851
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Expression Range	689-930aa
Protein Length	Partial
Mol. Weight	28.9 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
Subcellular Location	Secreted.
Protein Families	ITIH family
Database References	HGNC: 6169 OMIM: 600564 KEGG: hsa:3700 STRING: 9606.ENSP00000266041 UniGene: Hs.709406
Tissue Specificity	Liver specific.

Gene Functions References

Low ITIH4 expression is associated with Hepatocellular Carcinoma. PMID: 28828637
this report has further supported for associations of genetic variants in the ITIH4 and CALN1 genes with schizophrenia and provided the first evidence that the variants regulate ITIH4 AND CALN1 expression in the dorsolateral prefrontal cortex PMID: 26991396
ITIH4 peptide isoform as a preterm birth biomarker and its associated SNP implications PMID: 26408095
Serum ITIH4 may be a PM10-specific biomarker in COPD and may be related to inflammation. PMID: 25977605
Four novel body mass index-associated loci near the KCNQ1(rs2237892), ALDH2/MYL2 (rs671, rs12229654), ITIH4 (rs2535633) and NT5C2 (rs11191580) genes are identified in East Asian-ancestry populations. PMID: 24861553
Worse survival among HCC patients with low ITIH4. PMID: 24836184
Isoform-specific ITIH4 glycosylation and utilization of O-glycosylation sites on ITIH4 differs between cell lines and serum. PMID: 24884609
Expression of the 85 kDa ITIH4 was substantial in amyotrophic lateral sclerosis compared with controls or patients with muscular dystrophy, Alzheimer diseases, or Parkinson diseases PMID: 23436019
A truncated fragment of inter-alpha-trypsin inhibitor heavy chain 4 was the sole protein found to be significantly enhanced in the prostate cancer patients compared to the controls. PMID: 23417432
Findings suggest that ITI-H4 expression may be used as a biomarker, which could facilitate the development of novel diagnostic and therapeutic tools. PMID: 21331437
Genetic variation at ITIH4 locus is one of the likely candidate determinants for plasma cholesterol metabolisms PMID: 14661079
ITIH4 and MTJ1 co-immunoprecipitate from total liver protein extracts and SANT domain of HTJ1 protects the ITIH4(588-930) recombinant fragment PMID: 16271702
The inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4) protein was significantly present more in interstial cystitis than controls PMID: 18455532
ITIH4 is an anti-inflammatory protein, and suggests that further investigation into its potential use in the diagnosis and prognosis of acute ischemic stroke is warranted. PMID: 19263524

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.