Recombinant Human Inter-Alpha-Trypsin Inhibitor Heavy Chain H4 (ITIH4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04195P
Greater than 85% as determined by SDS-PAGE.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) ITIH4.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) ITIH4.
Recombinant Human Inter-Alpha-Trypsin Inhibitor Heavy Chain H4 (ITIH4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04195P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Inter-Alpha-Trypsin Inhibitor Heavy Chain H4 (ITIH4) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q14624 |
| Target Symbol | ITIH4 |
| Synonyms | 35 kDa inter-alpha-trypsin inhibitor heavy chain H4; gp120; H4P; IHRP; Inter-alpha-inhibitor heavy chain 4; Inter-alpha-trypsin inhibitor family heavy chain-related protein; Inter-alpha-trypsin inhibitor heavy chain H4; inter-alpha-trypsin inhibitor, heavy chain-like, 1; ITI heavy chain H4; ITI-HC4; ITIH4; ITIH4_HUMAN; ITIHL1; OTTHUMP00000197120; OTTHUMP00000197121; OTTHUMP00000213834; OTTHUMP00000213869; PK-120; PK120; Plasma kallikrein sensitive glycoprotein 120; PRO1851 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL |
| Expression Range | 689-930aa |
| Protein Length | Partial |
| Mol. Weight | 28.9 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration. |
| Subcellular Location | Secreted. |
| Protein Families | ITIH family |
| Database References | HGNC: 6169 OMIM: 600564 KEGG: hsa:3700 STRING: 9606.ENSP00000266041 UniGene: PMID: 28828637 |
