Recombinant Human Intelectin-1 (ITLN1) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-00638P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Intelectin-1 (ITLN1) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-00638P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Intelectin-1 (ITLN1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q8WWA0
Target Symbol ITLN1
Synonyms (ITLN-1)(Endothelial lectin HL-1)(Galactofuranose-binding lectin)(Intestinal lactoferrin receptor)(Omentin)
Species Homo sapiens (Human)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYS
Expression Range 19-298aa
Protein Length Full Length of Mature Protein
Mol. Weight 38.6 kDa
Research Area Cardiovascular
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Lectin that specifically recognizes microbial carbohydrate chains in a calcium-dependent manner. Binds to microbial glycans that contain a terminal acyclic 1,2-diol moiety, including beta-linked D-galactofuranose (beta-Galf), D-phosphoglycerol-modified glycans, D-glycero-D-talo-oct-2-ulosonic acid (KO) and 3-deoxy-D-manno-oct-2-ulosonic acid (KDO). Binds to glycans from Gram-positive and Gram-negative bacteria, including K.pneumoniae, S.pneumoniae, Y.pestis, P.mirabilis and P.vulgaris. Does not bind human glycans. Probably plays a role in the defense system against microorganisms (Probable). May function as adipokine that has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. Increases AKT phosphorylation in the absence and presence of insulin. May interact with lactoferrin/LTF and increase its uptake, and may thereby play a role in iron absorption.
Subcellular Location Cell membrane; Lipid-anchor, GPI-anchor. Secreted.
Database References

HGNC: 18259

OMIM: 609873

KEGG: hsa:55600

STRING: 9606.ENSP00000323587

UniGene: PMID: 29337272

  • Study shows omentin Val/Val (mutant homozygote) genotype increases predisposition to acne vulgaris by probably disrupting overall protein function of omentin. PMID: 30301508
  • The study showed for the first time serum omentin and visfatin levels to be decreased after lung transplantation in end-stage lung disease patients PMID: 29277835
  • ITLN1, PPARg AND TNFa GENE EXPRESSION IN VISCERAL ADIPOSE TISSUE. PMID: 30188100
  • Omentin may play a role in the pathophysiology of preterm births but it is not involved in the mechanism of preterm premature rupture of the membranes. PMID: 28440092
  • Loss of Omentin-1 expression is Associated with Carotid Plaque Instability among Ischemic Stroke Patients. PMID: 29225325
  • Val109Asp polymorphic marker of intelectin 1 gene is associated with abdominal obesity. PMID: 29482534
  • Reduced serum omentin-1 is associated with inflammatory mechanism and insulin resistance in the pathogenesis of diabetic nephropathy in type 2 diabetes mellitus patients. PMID: 28864059
  • The aims of this study were to evaluate and correlate circulating chemerin, apelin, vaspin, and omentin-1 levels in obese type 2 diabetic Egyptian patients with coronary artery stenosis (CAS), and to assess their usefulness as noninvasive diagnostic biomarkers. PMID: 28957639
  • six-month lifestyle weight loss intervention significantly increased serum levels in obese children PMID: 28833541
  • ITLN1 expression was significantly increased in asthmatic airways and in lesional skin of atopic dermatitis patients PMID: 28224996
  • Plasma omentin-1 level was significantly higher in patients with good coronary collateral circulation (CCC) than those with poor CCC (566.57+/-26.90 vs. 492.38+/-19.70 ng/mL, p=0.024). Besides, omentin-1 was positively correlated with total cholesterol, high-density lipoprotein, and gensini score but inversely with hyperlipidemia and body mass index (all p values0.05). PMID: 28123148
  • In conclusion, our study, which focused on hepatic FGF21 and omentin-1 mRNA expression, confirmed marked expression of both molecules in the liver of morbidly obese patients with NAFLD. PMID: 28820393
  • Myocardial injury leads to a decrease in ITLN1 expression in the heart and a corresponding increase in plasma levels PMID: 28687077
  • the effects of omentin-1 on KLF2 expression are mediated by p53. PMID: 29408455
  • Omentin levels are increased in cirrhotic patients without portal vein thrombosis, but do not influence platelet activity. PMID: 28465646
  • Omentin-1 levels are closely associated with the endogenous insulin reserve and may be used in follow-up of patients. PMID: 28073124
  • Omentin expression increases in the epicardial adipose tissueof non-obese coronary artery disease patients, despite a decrease in plasma levels, suggesting that omentin may play a role in the pathogenesis of coronary artery disease PMID: 27450783
  • Omentin-1 concentrations may be related to increased stroke risk PMID: 27298015
  • A decreased level of circulating omentin negatively correlated with white blood cells and procalcitonin in patients with acute respiratory distress syndrome. PMID: 27607575
  • Serum levels of omentin-1 were positively associated with increases in glycemia and incident type 2 diabetes in an older population. PMID: 28679518
  • These findings suggested that elevated serum omentin levels were only very mildly related to the changes in cardiac volume and function in chronic heart failure patients PMID: 27270246
  • Data suggest that circulating omentin-1 levels are lower in patients with PCOS (polycystic ovary syndrome) as compared to control subjects; circulating omentin-1 levels appear to correlate with insulin resistance but do not appear to correlate with overweight/obesity in these patients. [META-ANALYSIS] PMID: 27908216
  • In conclusion, DAB2 and Intelectin-1 are newly identified positive markers of mesothelioma and have potential to be included in future immunohistochemical marker panels for differentiation of epithelioid mesothelioma from pulmonary adenocarcinoma PMID: 28394802
  • This study showed that consumption of olive oil-rich diet tended to increase omentin and adiponectin in comparison with the usual diet. PMID: 27931137
  • Omentin concentrations were inversely associated with MMP-3 levels in rheumatoid arthritis patients. This relationship was influenced by population origin, rheumatoid arthritis activity and erythrocyte sedimentation rate. PMID: 27476070
  • High omentin expression is associated with Colorectal Cancer. PMID: 27216184
  • Our results indicate that the Asp allele of Val109Asp (T allele of rs2274907) is more frequent among men with coronary artery disease than healthy men, so it is possibly a risk factor for coronary artery disease in men only. PMID: 28325076
  • In type 2 diabetes mellitus, both chemerin and omentin enhance the body sensitivity to insulin, which results in increased glucose uptake and increased expression of the omentin gene was reported in nasal polyps and mesothelioma. PMID: 27516571
  • High omentin expression is associated with osteoporosis. PMID: 27614458
  • There was no difference in serum chemerin, vaspin and omentin-1 between polycystic ovary syndrome patients and healthy controls. PMID: 27225862
  • Atorvastatin increased serum omentin-1 concentrations in patients with coronary artery disease in a dose-dependent manner. PMID: 27749321
  • Omentin-1 might exert a negative effect on bone remodelling in girls with anorexia nervosa by inhibiting both bone formation and resorption. The OPG/sRANKL system plays an important role in the latter. PMID: 26662650
  • Low serum Omentin-1 level is Associated with Dilated Cardiomyopathy. PMID: 27313334
  • omentin, as compared to vaspin, seems to provide a better predictor of insulin resistance in obese individuals. PMID: 27449535
  • Data suggest that nonlinear resistance training or aerobic interval training for 12 weeks produces no significant changes in serum levels of omentin-1 and interleukin-18 in obese men; however, during a 4-week detraining period, omentin-1 decreases significantly and IL-18 increases significantly. PMID: 27636349
  • Omentin-1 expression in patients with coronary artery disease was lower in epicardial adipose tissue adjacent to coronary stenotic segments than non-stenotic segments PMID: 27352781
  • omentin reduces the development of atherosclerosis by reducing inflammatory response of macrophages through the Akt-dependent mechanisms PMID: 26714927
  • Omentin-1 levels were markedly reduced in coronary endothelium and epicardial fat but increased in plasma and atheromatous plaques (macrophages/SMCs) in coronary artery disease (CAD) patients compared with non-CAD patients PMID: 26790473
  • The mean serum omentin-1 concentration in adolescent girls with anorexia nervosa was higher than that of controls and obese girls. PMID: 25804090
  • Omentin levels were lower in both obese and non-obese PCOS patients compared to healthy controls. PMID: 26291814
  • Data show that the circulating omentin-1 levels were dramatically decreased in renal cell carcinoma (RCC) patients. PMID: 26539805
  • Although no significant difference was detected regarding omentin Val109Asp polymorphism, Val/Val genotype frequency was found to be more in patient group than control group. It may be speculated that Val/Val genotype increases the tendency for CAD. PMID: 24370683
  • Plasma omentin-1 concentrations were decreased in non-obese polycystic ovary syndrome individuals PMID: 26514948
  • Data suggest serum omentin/ITLN1 levels are down-regulated in elderly population (ages 61-82 years) with type 2 diabetes and polyneuropathy, independently of established risk factors of polyneuropathy; ITLN1 is positively correlated with adiponectin. PMID: 26094489
  • Serum omentin was associated with cardiac autonomic neuropathy in type 2 diabetes patients. PMID: 26466574
  • analysis of expression of maternal omentin-1 in humans and in the rat animal model PMID: 26144294
  • Lower levels of serum omentin in patients with pseudoexfoliation syndrome compared with healthy subjects may support the theory of systemic nature of the disease. PMID: 25264991
  • A decrease in omentin-1 levels could be an independent mortality risk factor in patient with diabetes on hemodialysis. PMID: 26293449
  • This study clearly indicates that acute aerobic exercise elicits a pro-inflammatory response (e.g. CHI3L1) with a lower anti-inflammatory effect (e.g. ITLN-1) in obese individuals. PMID: 26316585
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed