Recombinant Human Integrin Alpha-V (ITGAV) Protein (His)

Name: Recombinant Human Integrin Alpha-V (ITGAV) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10666P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Cluster of differentiation (cd) proteins, Featured cd protein molecules, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Integrin Alpha-V (ITGAV) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P06756
Target Symbol	ITGAV
Synonyms	antigen identified by monoclonal L230; CD 51; CD51; DKFZp686A08142; Integrin alpha five; integrin alpha V beta 3; Integrin alpha-5; integrin alpha-V; Integrin alpha-V light chain; integrin alphaVbeta3; integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51); ITAV_HUMAN; ITGAV; MSK 8; Msk8; Vitronectin receptor subunit alpha; VNRA; VTNR
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Expression Range	891-1048aa
Protein Length	Partial
Mol. Weight	19.7kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. ITGAV:ITGB3 binds to fractalkine (CX3CL1) and may act as its coreceptor in CX3CR1-dependent fractalkine signaling. ITGAV:ITGB3 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling. ITGAV:ITGB3 binds to FGF1 and this binding is essential for FGF1 signaling. ITGAV:ITGB3 binds to FGF2 and this binding is essential for FGF2 signaling. ITGAV:ITGB3 binds to IGF1 and this binding is essential for IGF1 signaling. ITGAV:ITGB3 binds to IGF2 and this binding is essential for IGF2 signaling. ITGAV:ITGB3 binds to IL1B and this binding is essential for IL1B signaling. ITGAV:ITGB3 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1. ITGAV:ITGB3 and ITGAV:ITGB6 act as a receptor for fibrillin-1 (FBN1) and mediate R-G-D-dependent cell adhesion to FBN1. Integrin alpha-V/beta-6 or alpha-V/beta-8 (ITGAV:ITGB6 or ITGAV:ITGB8) mediates R-G-D-dependent release of transforming growth factor beta-1 (TGF-beta-1) from regulatory Latency-associated peptide (LAP), thereby playing a key role in TGF-beta-1 activation. ITGAV:ITGB3 act as a receptor for CD40LG.; (Microbial infection) Integrin ITGAV:ITGB5 acts as a receptor for Adenovirus type C.; (Microbial infection) Integrin ITGAV:ITGB5 and ITGAV:ITGB3 act as receptors for Coxsackievirus A9 and B1.; (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Herpes virus 8/HHV-8.; (Microbial infection) Integrin ITGAV:ITGB6 acts as a receptor for herpes simplex 1/HHV-1.; (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Human parechovirus 1.; (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for West nile virus.; (Microbial infection) In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Cell junction, focal adhesion.
Protein Families	Integrin alpha chain family
Database References	HGNC: 6150 OMIM: 193210 KEGG: hsa:3685 STRING: 9606.ENSP00000261023 UniGene: PMID: 28695371 There is no difference in the expression of Integrin alphavbeta3 between tumor samples from glioblastomas patients with methylated or unmethylated promoter regions in the (6)O-methylguanine methyltransferase (MGMT). Further analysis of the integrin subunits via ELISA from histologic sections revealed that there is no difference in integrin subunit expression between these patients. PMID: 29882028 These data suggested CD51 was a predictor for the prognosis of esophageal squamous cell carcinoma patients PMID: 30049512 This study shows that the D2A sequence of the UPAR induces cell growth through alphaVbeta3 integrin and EGFR. PMID: 29184982 Cyclin D1b markedly amplified integrin alphavbeta3 expression, which was further up-regulated under lipopolysaccharide stimulation. PMID: 30074214 differential expression of alphavbeta3 and alphavbeta6 was examined in MDA-MB-231, MDA-MB-468 and MCF-10A cells, which signify three different stages of breast cancer development from highly metastatic to non-tumorigenic stage. PMID: 29577899 High expression of Integrin alphaVbeta6 is an important cause of active proliferation and impaired apoptosis in cervical cancer. PMID: 28682441 The results of the present study suggest that the traditional Chinese formula WD3 may inhibit gastric tumor growth, potentially via the downregulation of integrin alphav beta3 and the inhibition of ERK1/2 phosphorylation in vivo PMID: 29152665 of AIM-cleavage and resulting functional modification could be the basis for designing safe and efficient AIM therapy for various diseases PMID: 27929116 show that sCD40L/alpha5beta1 interaction leads to platelet activation as evaluated in the human whole blood PMID: 26719354 Among Greek and Polish patients with intracerebral hemorrhage, the rs7565633 tag SNP of the ITGAV gene was independently associated with the risk of lobar ICH in a codominant model of inheritance. PMID: 27476161 Although Mn(2+) potently activates other integrins and increases affinity of alphaVbeta6 for pro-TGF-beta1 25- to 55-fold, it increases alphaVbeta8 affinity only 2- to 3-fold. PMID: 28484027 ITGAVITGAVITGAV PMID: 27363302 This work identifies that therapeutic targeting of integrins containing an alpha V integrin unit inhibits cancer progression and thus may be of clinical benefit. PMID: 28314844 this study uncovers a novel pathway by which the TGFbeta-activating integrin alphavbeta8 is expressed in the human intestine on dendritic cell subsets, which is upregulated in patients with inflammatory bowel disease PMID: 27782111 Integrin alphavbeta3 has a role in enhancing beta-catenin signaling in acute myeloid leukemia harboring Fms-like tyrosine kinase-3 internal tandem duplication mutations PMID: 27248172 BKCa has a role in promoting growth and metastasis of prostate cancer through facilitating the coupling between alphavbeta3 integrin and FAK PMID: 27233075 Inhibition of S. aureus ClfA binding to endothelial cell alphaV beta3 by cilengitide prevents endothelial dysfunction PMID: 27606892 Data show that sulfatide promoted integrin alphaV(ITGAV) expression and stimulated integrin alphaVbeta3 clustering and signaling in hepatocellular carcinoma (HCC) cells. PMID: 27145276 in shENO1 pancreatic ductal adenocarcinoma (PDA) cells, downregulation of proteins involved in cell-cell and cell-matrix adhesion include alpha v/beta 3 integrin PMID: 28086938 Low integrin alphaVbeta3 expression is associated with glioblastoma. PMID: 26918452 Data show that FGF2 mutants have potential as anti-angiogenic agents and useful tools for studying the role of integrin alphavbeta3 in FGF2 signalling. PMID: 28302677 VANGL2 interacts with Integrin alphaVbeta3 to regulate matrix metalloproteinase activity and cell adhesion to the extracellular matrix. PMID: 29097183 The results indicate that shear stress is an important mediator in endothelial progenitor cells expression of CD59 regulated by the extacellular matrix-integrin alphaVbeta3-F-actin pathway, which is a key factor in preventing membrane attack complex-mediated cell autolysis. PMID: 28943429 The mechanism of resistance of tongue squamous carcinoma cells Cal27 with de novo integrin alphavbeta3 expression to anticancer drugs was studied. In Cal27 cells integrin alphav heterodimers signal through pSrc(Y418) while this is not the case in integrin alphavbeta3-expressing cells. PMID: 27108184 data demonstrate that M. tuberculosis stimulation upregulates integrin alphaVbeta3 expression on monocytes, which upregulates secretion of MMP-1 and -10 on adhesion to the extracellular matrix; this leads to increased monocyte recruitment and collagenase activity, which will drive inflammatory tissue damage PMID: 28646039 The synergy of circulating factor suPAR and APOL1 G1 or G2 on alphavbeta3 integrin activation is a mechanism for CKD. PMID: 28650456 overexpression of syndecan-1 confers to B-LCs an increased capacity to migrate in response to Tat, owing to a switch from a CXCR4/G-protein/Rac to a syndecan-1/alphavbeta3/pp60src/pp125FAK signal transduction pathway that depends on the formation of a complex in which syndecan-1 interacts with Tat via its HS-chains, with alphavbeta3 via its core protein ectodomain and with pp60src via its intracellular tail PMID: 27819680 These results indicate that CD51 is a novel functional marker for colorectal CSCs which may provide an therapeutic target for the efficient elimination of colorectal CSCs. PMID: 27593923 promoting differentiation of luminal A breast cancer cells by signaling emanating from Int-alphavbeta3 can potentially promote 'normalization' of their malignant phenotype and may prevent the malignant cells from progressing. PMID: 27906177 Data show that dendritic cells (DCs) induced Th17 cell differentiation through miR-363/Integrin alphav/TGF-beta pathway in patients with rheumatoid arthritis (RA). PMID: 28376277 Myocardial alphavbeta3 integrin expression represents a marker of ongoing cardiac repair following acute myocardial infarction. PMID: 27927700 integrin alphaVbeta6 binds pro-TGF-beta1 in an orientation biologically relevant for force-dependent release of TGF-beta from latency PMID: 28117447 In vitro binding assays with purified components reveal that Tie-integrin recognition is direct, and further demonstrate that the receptor binding domain of the Tie2 ligand Ang-1, but not the receptor binding domain of Ang-2, can independently associate with a5b1 or aVb3. cooperative Tie/integrin interactions selectively stimulate ERK/MAPK signaling in the presence of both Ang-1 and fibronectin PMID: 27695111 The findings suggest that, in contrast with previous models, the ligand-binding site of integrin alphaVbeta3, binds to the constant region (helices A and B) of the EC2 domain of CD9, CD81, and CD151 antigens. PMID: 27993971 Antiendothelial alphavbeta3 antibodies are a major cause of intracranial bleeding in fetal/neonatal alloimmune thrombocytopenia. PMID: 27283740 Integrin alphav is required for local activation of latent TGFbeta, and the wound healing defect in the setting of integrin alphav loss was rescued by exogenous, active TGFbeta. PMID: 27295308 Taken together, our findings suggested that HMGB1 enhances tumor cell migration ability by activating alphavbeta3/FAK through TLR4/NF-kappaB signaling, leading to metastasis of NSCLC. PMID: 27769864 these results show that differences in stiffness/fluidity due to alphavbeta3 integrin expression or integrin activation by Mn(2+) might not simply be explained by the coupling of integrins to actin via focal adhesions. PMID: 27553273 Thus, the alphaV integrin subunit is important for varicella-zoster virus gB/gH-gL-mediated viral membrane fusion and infection. PMID: 27279620 The blockage of alphavbeta3 integrin inhibited the FAK-Src association and VEGFR activation, thus reducing tubulogenesis. PMID: 27420801 in some cell lines the cellular entry of human parechovirus 1(HPeV-1) is primarily mediated by the active form of alphaVbeta1 integrin without visible receptor clustering PMID: 27128974 The results implied that these five single nucleotide polymorphisms in the integrin alphavbeta3 gene were not associated with hemorrhagic fever with renal syndrome susceptibility or severity in Han Chinese individuals in Hubei Province. PMID: 28190175 Gastric cancer patients who were both alphavbeta6 and MMP-9 positive had a shorter overall survival. PMID: 27076771 The results of this study demonstrate that molecular dynamics of alphav integrin-GFP can be imaged in lung metastasis, which will allow further understanding of the role of alphav integrin in this process. PMID: 27466481 Periostin expression in human periodontal ligament fibroblasts promotes the migration of human mesenchymal stem cells through the alphavbeta3 integrin/FAK/PI3K/Akt pathway in vitro. PMID: 25900259 Results showed that CD51 expression in pancreatic cancer stroma is associated with enhanced tumor malignancy. PMID: 26846197 endothelial VEGFR-2 appeared to be slightly superior to endothelial alpha v ss 3 for differentiating benign from cancerous lesions. PMID: 26902100 Identify integrin alphavbeta3 as a receptor ofNC1 domain of collagen XIX. NC1(XIX) inhibits the FAK/PI3K/Akt/mTOR pathway, by decreasing the phosphorylation and activity of the major proteins involved in this pathway. PMID: 26621838 In this study, the long binding helix of this ligand was downsized to an enzymatically stable cyclic peptide endowed with sub-nanomolar binding affinity toward the alphavbeta6 receptor and remarkable selectivity against other integrins PMID: 26663660

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Integrin Alpha-V (ITGAV) Protein (His)

Recombinant Human Integrin Alpha-V (ITGAV) Protein (His)

Product Overview

Target Details

FAQs