Recombinant Human Integrin Alpha-M (ITGAM) Protein (His-GST)
Beta LifeScience
SKU/CAT #: BLC-06857P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Integrin Alpha-M (ITGAM) Protein (His-GST)
Beta LifeScience
SKU/CAT #: BLC-06857P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Integrin Alpha-M (ITGAM) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P11215 |
| Target Symbol | ITGAM |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-GST |
| Target Protein Sequence | VLFQGPLGSPEFRTVVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDGRTRAPPPPPLRSGCQSPKGSVGCCHRAITSITPWGLTGLEGFFAERRNYIRIGEWDAPCSGALSAAGVVVTRSVTATLASALAPAPFAFFPSFLATFAGFPRQALNRGLPLGFRFSALRHL |
| Expression Range | 46-150aa |
| Protein Length | Partial |
| Mol. Weight | 57.1 kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Integrin ITGAM/ITGB2 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles and pathogens. It is identical with CR-3, the receptor for the iC3b fragment of the third complement component. It probably recognizes the R-G-D peptide in C3b. Integrin ITGAM/ITGB2 is also a receptor for fibrinogen, factor X and ICAM1. It recognizes P1 and P2 peptides of fibrinogen gamma chain. Regulates neutrophil migration. In association with beta subunit ITGB2/CD18, required for CD177-PRTN3-mediated activation of TNF primed neutrophils. May regulate phagocytosis-induced apoptosis in extravasated neutrophils. May play a role in mast cell development. Required with TYROBP/DAP12 in microglia to control production of microglial superoxide ions which promote the neuronal apoptosis that occurs during brain development. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. Membrane raft; Single-pass type I membrane protein. |
| Protein Families | Integrin alpha chain family |
| Database References | HGNC: 6149 OMIM: 120980 KEGG: hsa:3684 STRING: 9606.ENSP00000441691 UniGene: PMID: 28073885 |
