Recombinant Human Integrin Alpha-M (ITGAM) Protein (His-GST)

Name: Recombinant Human Integrin Alpha-M (ITGAM) Protein (His-GST)
Brand: Beta LifeScience
SKU: BLC-06857P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Cluster of differentiation (cd) proteins, Featured cd protein molecules, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Integrin Alpha-M (ITGAM) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P11215
Target Symbol	ITGAM
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-GST
Target Protein Sequence	VLFQGPLGSPEFRTVVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDGRTRAPPPPPLRSGCQSPKGSVGCCHRAITSITPWGLTGLEGFFAERRNYIRIGEWDAPCSGALSAAGVVVTRSVTATLASALAPAPFAFFPSFLATFAGFPRQALNRGLPLGFRFSALRHL
Expression Range	46-150aa
Protein Length	Partial
Mol. Weight	57.1 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Integrin ITGAM/ITGB2 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles and pathogens. It is identical with CR-3, the receptor for the iC3b fragment of the third complement component. It probably recognizes the R-G-D peptide in C3b. Integrin ITGAM/ITGB2 is also a receptor for fibrinogen, factor X and ICAM1. It recognizes P1 and P2 peptides of fibrinogen gamma chain. Regulates neutrophil migration. In association with beta subunit ITGB2/CD18, required for CD177-PRTN3-mediated activation of TNF primed neutrophils. May regulate phagocytosis-induced apoptosis in extravasated neutrophils. May play a role in mast cell development. Required with TYROBP/DAP12 in microglia to control production of microglial superoxide ions which promote the neuronal apoptosis that occurs during brain development.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Membrane raft; Single-pass type I membrane protein.
Protein Families	Integrin alpha chain family
Database References	HGNC: 6149 OMIM: 120980 KEGG: hsa:3684 STRING: 9606.ENSP00000441691 UniGene: PMID: 28073885 Expression of Mac-1 on the surface of human embryonic kidney (HEK) 293 cells induced their adhesion and migration to PTN. Accordingly, PTN promoted Mac-1-dependent cell spreading and initiated intracellular signaling manifested in phosphorylation of Erk1/2. PMID: 28939773 CD11b rs1143679 polymorphism appears to be associated with risk for SLE in the Han Chinese population, and may play an important role in the development of lupus nephritis. PMID: 29207897 alphaMbeta2 uses its alphaI domain to bind iC3b at the thioester domain and simultaneously interacts through a region near the alphaM beta-propeller and beta2 betaI domain with a region of the C3c moiety near the C345C domain. PMID: 28292891 Up-regulation of granulocyte and monocyte CD11b during plasma separation was C5-dependent. PMID: 29575196 This study shown the ITGAM expression in Microglia and Astrocytes in stroke, Alzheimer's disease, and Lewy body dementia. PMID: 28398520 CD11b expression on polymorphonuclear leukocytes from patients with ankylosing spondylitis stimulated with lipopolysaccharide is not different to that of healthy controls. PMID: 24373176 The use of CD33(+)CD11b(+)HLA-DR(-) cells as a predictive and prognostic biomarker. PMID: 27178742 Bone marrow mesenchymal stromal cells induce the rapid differentiation of CD11b+ myeloid cells from bone marrow progenitors, and such an activity requires the expression of nitric oxide synthase-2. PMID: 28183849 demonstrate for the first time a dependency of monocyte-platelet aggregates and CD11b expression on monocytes in the presence of atrial fibrillation (AF) and support the notion of a close relationship between AF, thrombogenesis and inflammation PMID: 26763077 Increased CD11b+ and CD200+ monocytes in those with a strong presence of BVN indicate that BVN development may be associated with retinal injury and a VEGF-mediated process that is either reflected or propelled by systemic changes in monocytes. PMID: 29049725 This study, we provide evidence supporting a crucial pathogenic role for alphaM-integrin (CD11b) in acute inflammatory demyelinating polyradiculoneuropathy mononuclear leukocyte trafficking. PMID: 27460017 TLR-stimulated macrophages from CD11B SNP carriers showed increased basal expression of IFN regulatory factor 7 (IRF7) and IFN-beta, as well as increased nuclear exclusion of FOXO3, which was suppressed by LA1-dependent activation of CD11b. PMID: 28263189 FRbeta as a novel CD11b/CD18 regulator for trafficking and homing of a subset of macrophages on collagen. PMID: 27534550 this study shows that upregulation of CD11b after stimulation with IL-8 is more pronounced in adults than in neonates, whereas fMLP induces changes in receptor expression that are of the same magnitude in neutrophils from neonates as from adults PMID: 27606963 Ingestion of amino acid supplement did not influence CD11b expression. PMID: 27384580 This metaanalysis indicates that polymorphisms in the pathways of immune complex clearance, such as the FcgammaRIIIa, FcgammaRIIIb, and ITGAM genotypes, are potential susceptibility genes for neuropsychiatric systemic lupus erythematosus. PMID: 26773105 Monocyte-platelet aggregates and CD11b expression on monocytes and granulocytes are increased in atrial fibrillation patients with proven thrombus formation. They seem to be appropriate biomarkers for stratification of thromboembolic risk in patients with AF. PMID: 26411420 CD11b immunophenotyping identifies inflammatory profiles in the mouse and human lungs. PMID: 26422753 There is direct interaction between C3(H2O) and CD11b. Contact-activated C3(H2O) is a novel ligand for CD11b/CD18 that mediates platelet-PMN complex formation and the binding of platelet-derived microparticles to PMNs. PMID: 26293614 increased in neonates with abnormal neuroimaging and/or severe neonatal encephalopathy PMID: 25655529 Data show that secreted aspartic protease 2 (Sap2) of Candida albicans inactivates human macrophage complement factor H (factor H), factor H-receptors CD11b/CD18 and CD11c/CD18. PMID: 26306739 we confirmed the similarities between epithelial ovarian cancer and fallopian tube, normal and adenocarcinoma using FOLR1, FOLR2, CD68 and CD11b markers PMID: 25971554 While total surface expression of CD11b and L-selectin on neutrophils was largely unaffected PMID: 26361072 CD11b expression level might be considered a prognostic biomarker for Acute Myeloid Leukemia patients. [meta-analysis] PMID: 26309131 analysis of neutrophil and monocyte expression of toll-like receptor 4, CD11b and reactive oxygen intermediates, and correlation with neuroimaging outcomes in preterm infants PMID: 25826119 The rs1143679 polymorphism is associated with systemic lupus erythematosus susceptibility in different ethnic groups and with lupus nephritis in Europeans. No association was found with rheumatoid arthritis. [Meta-Analysis] PMID: 25315704 the results identify dynorphins A and B as novel ligands for Mac-1. PMID: 26036990 A novel expanding CD11b+ conventional dendritic cell subpopulation dominates the infiltrating renal inflammatory milieu, localizing to the glomeruli, in lupus nephritis. PMID: 26512111 Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria PMID: 26852488 study supports the crucial role of GABP in myeloid cell differentiation and identified ITGAM/CD11b as a novel GABP target gene PMID: 26170143 Data indicate that Candida albicans beta-Glucan induces high IL-1 receptor antagonist (IL-1Ra) levels, independently from Dectin-1/complement receptor 3 (CR3). PMID: 25461401 A novel association of common variable immunodeficiency have been found with rare variants at the FUS/ITGAM (CD11b) locus on 16p11.2. PMID: 25678086 role of CD11b/CD18 in priming of human leukocytes by endotoxin glycoforms from Escherichia coli PMID: 25365491 Il-6-induced recruitment of CD11b+ CD14+ HLA-DR- myeloid-derived suppressor cells is associated with progression and poor prognosis in squamous cell carcinoma of the esophagus. PMID: 25238263 Results show the functional importance of integrin alpha M (ITGAM) in systemic lupus erythematosus (SLE) pathogenesis through impaired phagocytosis. PMID: 24886912 Examination of CR3 ( CD11b/CD18)mutant variants and mass spectrometry analysis of the N-glycosylation pattern of CR3 revealed that N-glycans located in the C-terminal part of the CD11b subunit are involved in binding and cytotoxic activity of CyaA. PMID: 25554420 newly revealed recognition specificity of alpha(M)beta2 toward unfolded protein segments and cationic proteins and peptides suggests that alpha(M)beta2 may serve as a previously proposed "alarmin" receptor with important roles in innate host defense PMID: 25613106 The HNA-1b allotype influences the Fc gamma RIIIb cooperation with Fc gamma RIIa, but not with CR3. PMID: 24945596 The altered expression levels of ITGAM and FCgammaRIIIA mRNA in systemic lupus erythematosus patients and their correlations with clinical data suggest that ITGAM and FCgammaRIIIA may play a role in this disease. PMID: 23708937 The transcript levels of ITGAM significantly decreased for the systemic lupus erythematosus risk allele (A) relative to the non-risk allele (G), in a dose-dependent fashion. PMID: 24608226 A new genome-wide significant association between ITGAM-ITGAX and IgA nephropathy. PMID: 25305756 A negative correlation was found between CD11b percentage and postinfarct left ventricular ejection fraction. PMID: 25136078 hnRNP K in PU.1-containing complexes recruited at the CD11b promoter: a distinct role in modulating granulocytic and monocytic differentiation of AML-derived cells. PMID: 25005557 This suggests that FcgammaRIIIb signals in association with macrophage-1 Ag. PMID: 25024378 Although CD11b was more frequently expressed in blast cells of patients with intermediate and unfavorable cytogenetic risk groups, this feature did not translate into different clinical outcome. PMID: 24782118 circulating trisomy 12 CLL cells also have increased expression of the integrins CD11b, CD18, CD29, and ITGB7, and the adhesion molecule CD323. PMID: 24829201 integrin alpha9beta1/CD11B levels in circulating neutrophils are significantly elevated in pneumonia patients PMID: 23257917 genetic polymorphism is associated with systemic lupus erythematosus in Brazilian patients PMID: 24269694 Complement receptor 3 (CR3) inhibition impairs phagocytosis of serum-opsonized zymosan but has little impact on phagocytosis of unopsonized zymosan in the absence or presence of lipopolysaccharide. PMID: 24726062

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.