Recombinant Human Integrin Alpha-Iib (ITGA2B) Protein (His)

Name: Recombinant Human Integrin Alpha-Iib (ITGA2B) Protein (His)
Brand: Beta LifeScience
SKU: BLC-09691P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Integrin Alpha-Iib (ITGA2B) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P08514
Target Symbol	ITGA2B
Synonyms	antigen CD41; BDPLT16; BDPLT2; CD41; CD41B; form 2; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; Integrin alpha 2b; Integrin alpha IIb; Integrin alpha-IIb light chain; Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITA2B_HUMAN; Itga2b; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb of IIb/IIIa complex; Platelet membrane glycoprotein IIb; platelet specific antigen BAK; PPP1R93
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR
Expression Range	639-887aa
Protein Length	Partial
Mol. Weight	29.0kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	Integrin alpha chain family
Database References	HGNC: 6138 OMIM: 187800 KEGG: hsa:3674 STRING: 9606.ENSP00000262407 UniGene: PMID: 30190457 mutations disturbing the alphaIIb R995/beta3 D723 salt bridge can cause an abnormal maturation of alpha-granules PMID: 29090484 ITGA2B gene mutations associated with Glanzmann thrombasthenia (Review) PMID: 29125375 Sanger sequencing of ITGA2B and ITGB3 in the index case followed by in silico modeling of all known GT-causing missense mutations extending from the lower part of the beta-propeller, and through the thigh and upper calf-1 domains. The index case, a Belgium type I GT patient, identiffied a homozygous c.1772A>C transversion (NC_000017.11:g.44379795T>G) affecting exon 18 of ITGA2B. PMID: 29385657 Kindlin supports platelet GPIIB IIIA activation by interacting with paxillin. PMID: 28954813 Type I Glanzmann thrombasthenia (GT)was found most common in our patients and with lowered mean CD41 expression in comparison with CD61. Type III GT patients had significantly lower numbers of severe bleeders, but the severity of bleeding did not vary significantly in type I and II GT patients PMID: 28948953 this study shows that in the Caucasian population the HPA-3 system confers susceptibility to acute cellular rejection after liver transplantation PMID: 28705752 Case Reports: alterations in the platelet proteome in type I Glanzmann thrombasthenia patients caused by different homozygous delG frameshift mutations in ITGA2B. PMID: 28078347 No genetic abnormalities identified in alpha2IIb and beta3: phenotype overcomes genotype in Glanzmann thrombasthenia. PMID: 27808476 study strongly supported the contribution of the genes ITGA2B, GSN and RHOA and the two pathways "regulation of actin cytoskeleton" and "leukocyte transendothelial migration" to osteoporosis risk. PMID: 27153759 Furthermore, the inside-out activation of GPIIb/IIIa of platelets mediated Streptococcus suis suilysin-induced platelet aggregation. PMID: 27800304 Data suggest that the extreme C terminus of kindlin-2 is essential for interaction with and activation of integrin alphaIIBbeta3; these studies were conducted in macrophage cell line and erythroleukemia cell line. PMID: 28652408 Both in cell lines and in mouse model, the extracellular matrix receptors including the integrin ( ITGA3 and ITGA2B), collagen ( COL5A1), and laminin ( LAMA5) were significantly inhibited by curcumin at messenger RNA and protein levels. PMID: 28618934 Case Report: Reduced binding of mutant FLNa to beta3 and the facilitated recruitment of talin by beta3 on platelet stimulation, explaining the increased alphaIIbbeta3 activation and the ensuing gain-of-platelet functions. PMID: 28428218 Mechanistic basis for the binding of fibrinogen-derived RGD- and AGDV-peptides to the platelet integrin alphaIIb-beta3 has been described. PMID: 28277676 the contribution of PAR1 and PAR4 to thrombin-mediated activation of the platelet fibrin receptor (GPIIbIIIa), is reported. PMID: 27784794 Integrin alpha-IIb beta-3 dependent ERK signaling is regulated by Src and Rho kinases in both Leu33 and Pro33 polymorphic isoforms. PMID: 27923225 Data suggest that CD41 and CD45 expression marked the onset of haemangioblastoma (HB) neovascularisation and the stepwise development of the angioformative period, and also the underlying therapeutic targets of anti-vascular treatment. PMID: 26468019 ITGA2B and ITGA8 have roles in prognosis in clear cell renal cell carcinoma patients PMID: 26198048 Thirteen variants in the ITGA2B locus and 29 variants in the ITGB3 locus were identified. PMID: 27965976 This study shows correlation of blood clot stiffness with platelet integrin alpha-IIb beta3 activity, aspirin usage, and transfusion risk in cardiopulmonary bypass patients. PMID: 26688324 Monomeric fibrin displayed a higher probability of interacting with Integrin alphaIIb beta 3 and a greater binding strength. PMID: 26867579 Data show that immune thrombocytopenia (ITP) is an autoimmune bleeding disorder characterized by low platelet count and presence of IgG autoantibodies to platelet surface glycoproteins, such as alpha IIbbeta3 integrins. PMID: 26301697 Data suggest that the ligand AGDV tetrapeptide binds to ITGB3/GPIIIa subunit and induces complete opening of headpiece of integrin alphaIIb/beta3 complex; AGDV appears to have very little contact with ITGA2B/GPIIb subunit. PMID: 26631735 Analysis showed a protective effect of TT genotype of ITGA2 807 C/T on fibrosis progression rate in Chronic Hepatitis C patients. PMID: 27093792 Activated but ligand-free integrins exist mainly in the compact conformation, whereas fibrin-bound alphaIIbbeta3 predominantly exists in a fully extended, headpiece open conformation. PMID: 26391523 Report novel ITGA2B mutations causing Glanzmann thrombasthenia. PMID: 25373348 Ibrutinib causes GPVI and integrin alphaIIbbeta3 platelet signaling deficiencies that result in formation of unstable thrombi and may contribute toward bleeding. PMID: 26359510 post-treatment of peptides derived from the full-length tail or from the turn motif did not reverse aIIb and aV integrin activation. PMID: 25290158 Data indicate 114 novel missense variants in integrin alpha 2b (ITGA2B) and 68 novel missense variants in integrin beta 3 (ITGB3). PMID: 25827233 Data (including data from molecular dynamic simulations) suggest specific interactions between glycoprotein GPIIb/GPIIIa complex transmembrane/C-terminal domains and talin-1 in cell membrane environment during platelet activation. PMID: 24677266 Anionic lipids in annular positions stabilize the alphaIIbbeta3 transmembrane complex by up to 0.50 +/- 0.02 kcal/mol relative to zwitterionic lipids in a headgroup structure-dependent manner. PMID: 25632962 ITGA2B rs5911 GG genotype is associated with decreased ex vivo antiplatelet activity of ticagrelor in healthy Chinese male subjects. PMID: 24474638 The genetic polymorphism of GP lIb-Illa (GP Ila Leu33Pro) was not noted to affect platelet aggregation. PMID: 25518511 data indicated that GPIIb-IIIa and GPIb levels are mainly affected by platelet size (MPV) but not by their genetic variations; in some acute coronary syndrome patients, production of large platelets with high GPIIb-IIIa and GPIb contents might be stimulated by elevated thrombopoietin PMID: 23941967 Intermolecular transmembrane domain interactions activate integrin alphaIIbbeta3. PMID: 24838247 The mechanism of kindlin-mediated activation of integrin alphaIIbbeta3.Kindlins have little direct effect on alphaIIbbeta3 integrin monomer affinity. PMID: 24210614 Data indicate that mutations in alphaIIbbeta3 integrins decreased ligand binding and adhesion. PMID: 24116162 The association of four common polymorphisms from four candidate genes (COX-1, COX-2, ITGA2B, ITGA2) with aspirin insensitivity PMID: 24244288 ADAP interacts with talin and kindlin-3 to promote platelet Integrin alphaIIbbeta3 activation and stable fibrinogen binding. PMID: 24523237 Increased mean platelet volume values correlated with increased platelet aggregation activity and enhanced GP IIb-IIIa and GP Ib expression. PMID: 24749250 These results map the binding of fibrin to multiple sites in the alphaIIb beta-propeller and further indicate that recognition specificity of alphaIIbbeta3 for fibrin differs from that for soluble fibrinogen. PMID: 24338009 these results establish that GP IIb/IIIa and alphavbeta3 integrins are essential mediators of shear flow-induced cancer cell mechanotransduction PMID: 24176823 Studies indicate that Glanzmann thrombasthenia (GT) is caused by quantitative or qualitative deficiencies of alphaIIbbeta3, an integrin coded by the ITGA2B and ITGB3 genes. PMID: 23929305 Our data indicate an important role for the region that links the distal calf-2 and beta-tail domains to their respective transmembrane (TM) domains in transmitting the conformational changes in the TM domains associated with inside-out activation. PMID: 24136164 dRP is a novel autocrine amplifier of platelet activity, which acts on platelet redox levels and modulates integrin alphaIIbbeta3 PMID: 23494007 Platelets lacking ERp57 have defective activation of the alphaIIbbeta3 integrin and platelet aggregation. The defect in aggregation was corrected by the addition of exogenous ERp57, implicating surface ERp57 in platelet aggregation. PMID: 24030382 the V740L polymorphism defines a new low-frequency antigen implicated in two cases of fetomaternal alloimmune thrombocytopenia in a single family PMID: 23305224 Integrin alphaIIbbeta3 was fully activated, independent of the morphological state of human platelets. PMID: 23571313 These results demonstrate that serine/threonine phosphatases, probably PP2A, regulate both inside-out and outside-in mechanisms of signal transduction and clot retraction through Platelet Glycoprotein GPIIb-IIIa Complex in human platelets. PMID: 24096143

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Integrin Alpha-Iib (ITGA2B) Protein (His)

Recombinant Human Integrin Alpha-Iib (ITGA2B) Protein (His)

Product Overview

Target Details

FAQs