Recombinant Human Integrin Alpha-4 (ITGA4) Protein (His-GST)

Name: Recombinant Human Integrin Alpha-4 (ITGA4) Protein (His-GST)
Brand: Beta LifeScience
SKU: BLC-07477P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Integrin Alpha-4 (ITGA4) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P13612
Target Symbol	ITGA4
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-GST
Target Protein Sequence	GDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEGLQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCR
Expression Range	376-558aa
Protein Length	Partial
Mol. Weight	51.5 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Integrins alpha-4/beta-1 (VLA-4) and alpha-4/beta-7 are receptors for fibronectin. They recognize one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. They are also receptors for VCAM1. Integrin alpha-4/beta-1 recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-4/beta-7 is also a receptor for MADCAM1. It recognizes the sequence L-D-T in MADCAM1. On activated endothelial cells integrin VLA-4 triggers homotypic aggregation for most VLA-4-positive leukocyte cell lines. It may also participate in cytolytic T-cell interactions with target cells. ITGA4:ITGB1 binds to fractalkine (CX3CL1) and may act as its coreceptor in CX3CR1-dependent fractalkine signaling. ITGA4:ITGB1 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	Integrin alpha chain family
Database References	HGNC: 6140 OMIM: 192975 KEGG: hsa:3676 STRING: 9606.ENSP00000380227 UniGene: Hs.440955

Gene Functions References

defines molecularly distinct subsets of articular cartilage that are enriched for osteochondral proteins PMID: 30194383
study suggests a novel association of ITGA4 +3061A/G polymorphism with AD and its possible contribution to the disease pathology. PMID: 29769839
The results of this study demonstrated that aggregation of hWJSCs into spherules alters their expression of ITGA4 and ITGA5. PMID: 29411210
human ADAM11, ADAM23, and ADAM29 selectively support integrin alpha4-dependent cell adhesion. PMID: 28913673
Recombinant human IL33 inhibited trophoblast invasion and adhesion, and decreased adhesion and invasionassociated molecules such as integrin alpha4beta1 and CD62L. PMID: 28765940
study analyzes for the first time the expressions of epithelial-mesenchymal transition marker proteins - periostin, integrin alpha4, fibronectin - in metastatic castration-resistant prostate cancer PMID: 28836852
ITGalpha4beta1 and TLR4 have roles in inducing fibrotic gene expression in response to fibronectin's EDA domain PMID: 28842322
ITGA4 and PLCG1 are regulated by miR-30b in coronary artery endothelial cells from coronary atherosclerosis clinical samples. PMID: 27464494
Low CD49D expression is associated with chronic lymphocytic leukaemia in comparison to small lymphocytic lymphoma. PMID: 29153094
alpha-Integrin expression and function modulates presentation of cell surface calreticulin. PMID: 27310876
AEbeta7 is of key relevance for gut trafficking of inflammatory bowel disease (IBD) CD8(+) T cells and CD4(+) Th9 cells in vivo and mainly retention might account for this effect. These findings indicate that blockade of alphaEbeta7 in addition to alpha4beta7 may be particularly effective in intestinal disorders with expansion of CD8(+) and Th9 cells such as IBD. PMID: 27543429
sPLA2-IIA activates Integrin alphaVbeta3 and Integrin alpha4beta1 in an allosteric manner. (Review) PMID: 27864802
Our results suggest that the analysis of alpha4beta7 integrin expression on circulating lymphocytes cannot be considered a reliable test for gastrointestinal involvement in CVID patients PMID: 28323147
Glycosylation of V1V2 domain of HIV envelope protein determined its binding to alpha4ss7 integrin. PMID: 28577856
confirmed CD49d as an independent negative OS prognosticator in CLL also in comprehensive models comprising the novel recurrent mutations. PMID: 27109509
In colon cancer samples, there was a positive correlation between the expression of integrin alpha4 and VEGF-C. Integrin alpha4 and VEGF-C were significantly associated with the clinicopathological parameters (LMVD, Duke's stage, and lymph node metastasis). patients with high integrin alpha4 or VEGF-C expression had significantly shorter overall survival and tumor-free survival time. PMID: 26917449
Macrophage tissue factor prothrombotic activity is regulated by integrin-alpha4/arf6 trafficking. PMID: 28495929
gut-homing alpha4beta7 CD4(+) T cells and their functional subsets were profoundly depleted during acute HIV-1 infection. PMID: 26277899
CD49d determination may be a useful tool to closely monitor Multiple Sclerosis activity in patients who interrupt Natalizumab PMID: 27496090
Data show tht Rho kinase (ROCK) activity was increased by inhibiting integrin alpha4 with human umbilical vein endothelial cells (HUVECs) and hypoxia. PMID: 26448639
These data showed that Mycobacterium tuberculosis ESAT-6 and ESAT-6/CFP-10 fusion proteins could induce adhesion of macrophages to fibronectin through alpha4beta1 integrin. PMID: 25081983
This review gives an up to date insight into the multiple functional role of VLA-4 in cancer and introduces this integrin as a promising target worthwhile to attract attention in biomedical cancer research. PMID: 25564456
Enhanced susceptibility of activated endocervical CD4+ T cells to HIV may be related to increased CCR5 expression by these cell subsets, but did not appear to be due to direct interaction of integrins a4b7 or a4b1 with HIV envelope. PMID: 25872482
knockdown of PTTG1 increased expression of integrin alpha 4 (ITGA4), ITGA5, and integrin beta 1 (ITGB1); otherwise, RhoA expression was significantly decreased PMID: 26900962
ITGA4 expression enhances metastasis in MYCN low neuroblastoma. PMID: 25973900
Data show that a small molecule inhibitor of the MYC transcription factor can be an effective anticancer agent when delivered using a integrin alphavbeta3 and VLA-4-targeted nanotherapy approach. PMID: 25824336
Collectively, these data suggest a role for alpha4beta7 integrin in HIV infection that is influenced by both viral and host factors including the sequence of the HIV gp120 alpha4beta7 binding motif, the cytokine milieu and bacterial vaginosis in the genital tract. PMID: 26105197
Glioma cells induced the migration of BMSCs by promoting the expression of integrin a4. PMID: 26034878
CD49d and CD26 have independent prognostic value and we suggest its use as a part of routine panel for prognostic stratification of CLL. PMID: 26142332
Hypermethylation of ITGA4 promoter is increased in inflamed colon tissue. PMID: 25902909
Regulatory CD4 T cells (Treg) cells in co-infected patients present phenotypic alterations and might have dysfunction marked by low expression of Foxp3 and increased expression of molecules not frequently seen on Treg cells, such as CD49d. PMID: 26329520
High VLA-4 expression was independently associated with a high probability of complete remission in acute myeloid leukemia patients. PMID: 26155911
Results show that integrin activation is absolutely required for OPN binding to the alpha4 integrin suggesting that OPN has very low affinity for the alpha4 integrin on human leukocytes under physiological conditions. PMID: 25446551
alpha4beta7 serves as an attachment factor for some HIV-1 strains. PMID: 25527342
Selective inhibition of VLA-4 expression on B cells impedes central nervous system accumulation of B cells and reduces susceptibility to experimental autoimmune encephalomyelitis. PMID: 25712734
The carbon monoxide signaling pathway can rapidly down-modulate binding of the VLA-4 -specific ligand. PMID: 25367365
CXCR4 and CD49d are important modulators of prognosis in chronic lymphocytic leukemia patients. PMID: 25349153
Proinflammatory secreted phospholipase A2 type IIA (sPLA-IIA) induces integrin activation through direct binding to a newly identified binding site (site 2) in integrin alphaVbeta3, integrin alphavbeta1, and integrin alpha4beta1. PMID: 25398877
LFA-1 and CR4 alpha chain phosphorylation is needed for chemokine-induced cross-talk to VLA-4 PMID: 25278023
HIV-1 virions and many gp120s lack detectable alpha4beta7 binding activity. PMID: 25008916
lymphocyte trafficking into the CNS under VLA-4 blockade can occur by using the alternative adhesion molecules, PSGL-1 and MCAM, the latter representing an exclusive pathway for TH17 cells to migrate over the blood-brain barrier PMID: 25135296
DNA methylation of integrin alpha4 may be a poor prognostic factor which affects undifferentiated histologic change of breast cancer. PMID: 24756760
Disruption of the hydrophobic contacts induces the active conformation of integrin alpha 4 beta 7. PMID: 24802248
Pharmacological inhibition of the VLA-4/vascular adhesion molecule-1 axis in experimental stroke was ineffective PMID: 24743435
Data indicate that CD47 in cis interactions regulate LFA-1 (integrin alphaLbeta2) and VLA-4 (integrin alpha4beta1) integrin affinity, and this process plays a substantial role in the adhesion of T-cells. PMID: 24006483
VCAM-1/VLA-4-dependent activation of NF-kappaB has a role in mediating chemoresistance in leukemia cells PMID: 24599548
Two conserved disulfide bonds located at integrin alpha4C589-C594 and beta7C494-C526 activated alpha4beta7. PMID: 23986478
Only rotavirus specific CD4 T cells expressed intestinal homing receptors alpha4beta7 and CCR9. PMID: 24606696
Data suggest CD38 (CD38 antigen (p45) protein) and CD49d (alpha4 Integrin; very late antigen-4 alpha) are more than just markers of an aggressive chronic lymphocytic leukemia (CLL) cell type and play functional roles in pathobiology of CLL. [REVIEW] PMID: 24288111
Expression of the VLA-4-stimulating factor sequence may help to predict melanoma prometastatic risk. PMID: 23938462

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.